KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015893Help
Entry
CpipJ_CPIJ015893  CDS       T01079                                 

Definition
disulfide isomerase
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CpipJ_CPIJ015893
Enzymes [BR:cqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CpipJ_CPIJ015893
Exosome [BR:cqu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CpipJ_CPIJ015893
  Exosomal proteins of colorectal cancer cells
   CpipJ_CPIJ015893
  Exosomal proteins of bladder cancer cells
   CpipJ_CPIJ015893
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 484 aa AA seqDB search
MFFAKVLFLAAVAIPAAFAGEADVLDLTDADFASRVAETETTLVMFYAPWCGHCKKLKPE
YAKAAELVRGEDPPIALAKVDCTEGGKETCNKFSVSGYPTLKIFKNGEVSQEYSGPREAS
GIAKYMKSIVGPASKDLLTVEAFDAFLKVQETSVVGFFQKESDLKGVFLKYADSQRERLR
FGHSSAQAVLDKQGETDAILSVPCSSWPTNSSRTLSSSRARQGGADHLHFHGLSGVRTRD
TQADFKNPLVVVYYAVDYVKNPKGTNYWRNRVLKVAKEFVGRVNFAVSAKDDYQHELNEY
GYDYVGDKPLVLARDAKNQKFIMKDEFSVENLQTFAGELEEGALEPYVKSEPIPESNDAP
VKIAVGKNFEDVVTNNGKDTLVEFYAPWCGHCKKLTPVYDELATKLKDEEVAIVKMDATA
NDVPPTFDVRGFPTLYWLPKDDKSNPKRYEGGREVDDFLKYIAKHATSELKGFDRKGSAK
KVEL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcgccaaagtgctgttcctggccgcggtggccatcccggcggcgtttgccggt
gaagccgacgtcctggatctgaccgacgcagactttgccagccgggtcgccgagaccgaa
actacgctggtcatgttctacgccccgtggtgcggtcactgcaagaagctgaagccggag
tacgccaaggccgccgagctggtccgcggcgaagacccaccgatcgcgctcgccaaggtc
gactgtaccgagggtggcaaggaaacttgcaacaagttctccgtgtcgggctacccgacg
ctgaagatcttcaagaatggcgaagtttcgcaagagtacagcggcccccgggaggccagc
ggtatcgccaagtacatgaagtcgatcgtcggcccggcctcgaaggatctgctcacggtg
gaggcgttcgacgcgttcctcaaggtgcaggagaccagcgtggtcgggttcttccagaag
gagtcggacttgaagggagtcttcctgaagtacgccgacagccagcgcgaacggttgcgc
tttggacactcgagcgcgcaagctgtgttggataagcagggcgagactgacgcgatctta
tctgttccgtgcagcagctggccaacaaattcgagccggactttgtcaagttcgagggca
agacaaggaggagctgaccaccttcacttccatgggttgagcggcgttcgtacgcgcgat
acccaggccgacttcaagaacccgctcgttgtggtgtactacgccgtggattacgtgaag
aaccccaagggaaccaactactggcgtaaccgtgttctgaaggtggccaaggagtttgtg
ggccgcgtcaactttgccgtcagtgccaaggacgactaccagcacgagctgaacgaatac
ggatacgactacgtcggcgacaagccgctggtgctggcccgcgacgccaagaaccagaag
tttatcatgaaggatgaattctccgtcgagaacctgcagacctttgccggtgagctggag
gagggtgcgctggaaccgtacgtcaaatccgaacccatcccggagagcaacgacgccccg
gtcaagattgccgtcggcaagaacttcgaggatgtcgtcaccaacaacggcaaggacacc
ctggtcgagttctacgcgccgtggtgcggccactgcaagaagctgaccccggtctacgac
gagctggcaaccaagctgaaggacgaggaggtcgccatcgtcaagatggacgcgaccgcc
aacgacgtgccgcccacgttcgacgtccgcggcttcccgacgctgtactggctgcccaag
gacgacaagagcaaccccaagcgctacgagggtggccgcgaggtggacgacttcctcaag
tacatcgccaaacacgccaccagcgagctcaagggattcgaccgcaagggaagcgccaag
aaggtcgagctgtaa

DBGET integrated database retrieval system