KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ015895Help
Entry
CpipJ_CPIJ015895  CDS       T01079                                 

Definition
cell division protein kinase 4
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     CpipJ_CPIJ015895
Protein kinases [BR:cqu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   CpipJ_CPIJ015895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 317 aa AA seqDB search
MASGNNNKQNHQAVSMFQMSSNYEELNVIGTGAYGTVYKARDLGNEGKIVALKKVRVALT
EDGVPMSTLREIALLKQLDAFQHPNVVKLLDVCHGPRLEREGQLVLFLVFEHLEQDLDDY
IKRLPPGGMPRMTIQRLSRELLTGVDFLHSHRIIHRDLKPQNLLISAQGRLKLADFGLAK
TYDFEMKLTTVVVTLWYRAPEVLLGEPYHSSVDIWSSGCIIAEMFQRVALFPGTSEGNQL
EKIFELTGRPSESQWPRGISVARENFRPTIQREPRELCPKLCDFSNDLLKKMLAFNSRDR
PSAFQCLQHAYFTQEPM
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgggcaacaacaacaaacagaaccaccaagccgtaagcatgttccagatgagc
tcaaactacgaggagctgaacgtgatcggaacgggtgcctacggtacggtttacaaagct
cgagatcttggcaatgagggcaaaattgtggcactgaaaaaggtccgggtggccctgacc
gaggacggtgttccgatgtccacgttgcgagaaatcgcgctgctgaagcaactggatgcg
ttccagcatcccaatgtggtcaaattactggacgtttgtcacgggccccggttagagcgc
gaaggtcagctggttttgttcctggtcttcgaacatctggagcaggacctagacgattac
atcaagcggcttcctccgggaggaatgcctcgaatgacaattcagcgcctctcccgcgag
ctgctgaccggtgtcgactttctgcactcgcaccgcatcatccaccgcgatctgaaaccg
cagaatctcctgatttcggcccagggtcggctcaagctggccgactttgggctcgccaaa
acgtacgactttgagatgaagctgacgacggtggtggtgacgctgtggtaccgggccccg
gaagtgctgctcggcgagccgtaccacagctcggtggacatctggagctcgggctgcatc
atcgcggaaatgttccaacgggtggcgctgttcccgggaacgtccgagggcaaccagttg
gagaagattttcgaattgacgggccgcccgtcggagagccagtggccgcgcggcatctcg
gtggcgcgggaaaacttccggccgaccattcagcgggaaccgcgcgaactttgccccaag
ctgtgtgacttttccaacgacctgctgaagaaaatgctcgcgttcaactcgagggatcgg
ccgtcggcgttccagtgtctgcagcatgcgtactttacgcaggaaccgatgtag

DBGET integrated database retrieval system