KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016192Help
Entry
CpipJ_CPIJ016192  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Other glycan degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cqu00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 664 aa AA seqDB search
MKLLLFATCLLFLVALWFWGFLYTTHVSDGGKIVSVKELMMGGGGGASHRESLLQRLGFY
EEDEEGGPAAGVRFVKPTGSLAIRNKGKFYNEWEAILQDRDEGPHSSRQEVKRKTAEELR
VAAEKQNHYEHELKKMGVPVIAGLGPGGHPPPVQRLVHLDLKGAPPKVSYLKRLMPIMKT
LGATGILLEYEDMFPYSGPLASIAAKNAYSKEDVQEILQTAFALGLTVIPLVQTFGHLEF
VLKLQEFQHIREVDDAPQALCPSQNSSMVLLEELLDQVIECHTPPHNVNLLHKEDLAKLT
PKLTHIHIGCDEVFQIAQCNRCKNRLKDTLFLDHVYNVVTMIHKKWPHLKVIIWDDMLRH
ISLETLQASGIGKLVEPMIWVYAEDIYKFIQSSTWDKYSTVFSTAWAASAFKGAHGEALL
LPPVRRHLENTLRWLVVMQGEGTRFSNGLQGLALTGWQRYDHFAILCELLPTSLPSLAVC
LSTASRGYFDVNPKTNSILSSLTCPEPTSERHAWIELHKDSMLSTFSRCMFPGSVIYRFV
LRLMTLMTEAKEYIDEVKQKRGWLTDYNIRHNFTSGTRVDDLLGDDYRLLNSITNLARNA
ASTLADVYDHWTSGEFIEQRIYPILAELKNLERIGEGLKKRKTWPQRPLPYLKPFEALGI
DEKT
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcttctgttcgcgacctgtttgctctttctggtcgcgctctggttctggggt
ttcctgtacacaacgcacgtgtcggacggtggcaagatcgtgtccgtcaaggagctcatg
atgggcggagggggcggcgccagccaccgcgaaagtctgctccagcggctcggcttctac
gaggaggacgaagagggaggtcctgcggcgggcgttcggttcgtgaagcccacggggagt
ctcgcgattaggaataaagggaaattctacaacgagtgggaggccattcttcaggatcgt
gatgaggggccacatagctccagacaggaggttaaacgaaagactgccgaagaactgcgc
gttgcagcggagaaacagaaccactatgaacacgagctcaaaaagatgggcgtgccggtg
attgccgggttaggaccgggtggtcatccacctccggtgcagcggttggtacatctagac
ctgaaaggggcaccacctaaggtttcatacctgaaaaggttgatgccaattatgaaaaca
ttgggagctacgggcatcctgttggagtacgaggacatgttcccatacagcggaccacta
gcttcgattgccgcgaaaaatgcctacagcaaagaagatgttcaagaaatcctacagaca
gcatttgccttaggcttaactgttatcccactggtgcaaacctttggccatttggagttt
gtactcaagttgcaagaatttcaacatattcgtgaagtcgacgatgctccacaggcactc
tgtccaagtcaaaactcgtccatggtattgctggaagagcttctcgatcaagtgattgaa
tgccacactccaccccacaatgtaaacctgttacacaaggaagacttggccaaactcacc
cctaagctgacccacattcacattgggtgtgacgaagtgtttcaaatcgcgcagtgcaat
cgttgcaagaatcggctgaaggataccctatttctcgatcacgtgtataacgtagtcacg
atgattcacaaaaagtggccccatttgaaagtgattatctgggacgatatgttgagacac
atttcgctggaaacattgcaagcttccgggatcggtaagctggtggaaccaatgatctgg
gtttacgcagaagatatctacaagttcattcagtcgtcgacctgggacaaatactcaacg
gttttcagcaccgcatgggccgcttctgccttcaaaggagcccacggtgaagcgctgctg
ctgccgccggttcgtcgtcacctggagaacaccctccgttggctggtggttatgcagggt
gaaggaactcgcttcagcaatggcttgcaagggctagccctcaccggttggcaacgatac
gaccattttgccatcctctgcgagttgcttccaacgtccctgccctcgcttgcggtatgt
ctatcgacggcatctcgaggctatttcgatgtgaatcccaaaaccaactccatcctgagc
agcctaacctgtcccgaaccaacgagcgaacggcacgcgtggattgagcttcacaaggat
tcgatgctatcgaccttttcgagatgcatgtttccaggcagtgtaatctaccggtttgtt
ctacgactaatgacccttatgaccgaggccaaagagtacatcgatgaggtcaagcagaaa
cgtggttggctaacggattacaacatccgtcacaatttcacctcggggacgcgcgtagac
gatctgcttggagatgattacagactgttaaactccataaccaatctagcgcgaaatgcc
gcatccacgctagcggatgtttacgaccattggacttccggggagtttatcgagcagcgc
atttaccccatactggctgagctgaagaatctcgagcggatcggggaaggactgaaaaag
cgcaagacttggccgcagcgacctctgccctacctgaaaccgttcgaagcgctcggaatc
gacgagaaaacctag

DBGET integrated database retrieval system