KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016406Help
Entry
CpipJ_CPIJ016406  CDS       T01079                                 

Definition
L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 227 aa AA seqDB search
MAWRSRGLSNADLIRQLQEYGIIKSEAVAQAMTATDRKFYVASNLQPYVDSPQRIGHGAT
ISAPHMHAYALELLEGYLKPTSKVLDVGSGSGYLTACFARYIHQKPNATGLVVGIEHHPA
LVQLGRSNIRADDGALLDSGKIVLIEGDGRLGSKEHAPYDCIHVGAAAPETPLELINQLK
PGGRLIVPVGPDGGTQYLEQYDKDQDGKVAKTRLMGVMYVPLTDLHT
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcgctcccggggactttcaaacgcggatctgatccgccagctgcaagaatac
ggcataatcaagagcgaagcggtggcccaagcgatgaccgcgacggaccggaagttttac
gtggccagcaacctgcagccgtacgtcgactcgccgcagcggatcgggcacggtgccacc
attagtgccccgcacatgcacgcctacgcgttggaactgctggaaggctacctgaaaccg
acgagcaaggtgctggacgtgggttccgggtccgggtacttgacggcctgcttcgcacgc
tacattcaccagaagccaaacgcgaccggcctcgtggtgggaatcgagcaccatccggcg
ctggtgcagcttggacggagcaatatccgcgcggacgacggggcgctgctggactcgggc
aagatcgtgctcattgagggcgatggtcggctgggcagcaaggagcacgccccgtacgat
tgcatccacgtcggagcggccgcgccggaaacaccgctggagctcattaaccagctgaaa
cccggtggtcggttgatcgtgcccgttggaccggacggtggcacgcagtacctggagcag
tacgacaaggatcaggacgggaaggtggccaagacgcgcctcatgggggtgatgtacgtg
ccgctgacggatcttcacacgtga

DBGET integrated database retrieval system