KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016441Help
Entry
CpipJ_CPIJ016441  CDS       T01079                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CpipJ_CPIJ016441
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CpipJ_CPIJ016441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 228 aa AA seqDB search
MTTWLPLESNPDVLNKYLEKLGVSPLWNIVDIYSMDDDALAFVPSPLKSLIFLFPCSDVY
EEFRAKEDAELKAKNIEHPKDLFYLRQYVHNACGTIALVHAVLNNPDIELTEGSVMKKYL
DGARDLSPEERGKLLENDAGFTETHESVANEGQTAAPDINEKVYHHFVAFVHHGGKLYEL
DGRKNFPVEHGATTPDSLLKDAIGVCKQYIARDPTEVRFTLMGLTPTQ
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctggttgccactggaatcgaacccagatgttctcaacaaatacctggaaaag
ctgggcgtttcgccgctgtggaacatcgtggacatttacagcatggacgatgacgcgctg
gcctttgtcccgagcccgctgaagtcgctgattttcctgtttccctgttccgatgtgtac
gaagagttccgcgccaaggaggacgccgagctgaaggcaaagaacatcgaacatccgaag
gacctgttctatctgaggcagtacgtgcacaatgcttgcggcaccatcgccctggtccac
gccgttctcaacaatccggacatcgaactgaccgagggttccgtcatgaagaagtatctg
gatggcgcccgcgatctcagcccggaggagcgtggcaagctgctggagaatgacgccggg
ttcaccgagacgcacgaatcggtggccaacgagggtcaaacggccgcgccggacattaac
gagaaggtgtaccaccactttgtggcctttgttcaccacggcggaaagctgtacgagctg
gacgggcgcaagaacttccccgtggagcatggagcaaccacgccggacagtctgctcaag
gatgccatcggcgtttgcaaacaatacatcgcacgcgacccgacggaagttcgcttcaca
ctgatgggactgactcccacccagtaa

DBGET integrated database retrieval system