KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016639Help
Entry
CpipJ_CPIJ016639  CDS       T01079                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cqu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cqu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cqu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cqu00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 668 aa AA seqDB search
MPSEPKLFNPHPDVAEKAYINSMDQYREYYRQSVENPAQFWSNVAKQFHWETPYDPQNFM
SYNFDISKGPIFVKWMEGASTNISYNLLDRNVRNGLGDTVAYYWEGNHPDDYSRLTYRKL
LEEVCRFANVLKSHGVQKGDRVSIYMPMVMELPVAMLACARIGAVHSIVFAGFSSDSLAE
RMHDCQAKVLITADGAWRGEKILHLKNICDEAMTKAEEMGHRVGTCVVVSHINRVTPGNS
AWDGEFDTPWTDDRDFWWHQEMEEADTSCYPEWMAAEDPLFMLYTSGSTGKPKGVLHTTA
GYLLYAATTFKIVFDYKPHDVYWCTADIGWITGHTYVLYGPLANGATSVMFEGSPFFPEN
DRYWEVVDKYKVTQFYTAPTAIRSLMKYGDEPVLKHDLSTLRVLGSVGEPINPEAWMWYY
KVVGKEKCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDESGNEVKGE
GEGYLVFSQPWPGMMRTLFNNHPRYESTYFSKFNGFYCTGDGARRDADGYYWVTGRVDDM
LNVSGHLMSTAEVESVLTEHTRVSEAAVVSRPHPVKGECLYCFITPNQNEVFDKTLINEL
KVLVRERIGPFAQPDVIQHAPGLPKTRSGKIMRRVLRKVAVNDREIGDTSTLADEAIIEQ
LFANRPVA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgccctctgaaccgaaactgtttaacccgcacccggatgtggccgaaaaggcgtacatc
aacagcatggaccagtaccgggagtactaccgccagtcggtggagaatcccgcccagttc
tggagcaatgtggccaagcagttccactgggagaccccgtacgacccgcagaacttcatg
tcgtacaactttgacatctccaaggggccgatcttcgtcaagtggatggagggcgcctcg
accaacatcagctacaacctgctcgatcggaacgtccggaacggccttggcgacacggtg
gcctactactgggaaggcaaccacccggacgactacagccggctgacgtaccgcaagctg
ctcgaggaggtatgccggttcgcgaacgtgctcaaatcgcacggcgtccagaagggtgac
cgcgtgtcgatctacatgcccatggtcatggaacttccggtggcgatgctcgcctgtgcc
cgcatcggcgccgtccactccattgtgtttgccggcttttcgtcggactcgctggccgag
cggatgcacgactgtcaggccaaggtgctgatcacggccgatggggcttggcgtggcgag
aagatcttgcacctgaaaaacatctgcgatgaggcgatgacgaaggctgaggagatggga
caccgagttggtacgtgcgttgtggtgtcgcacatcaaccgggtgactccgggaaattcc
gcctgggatggggagtttgataccccctggacggacgatcgcgacttttggtggcaccag
gagatggaagaagccgacacgtcttgctatccggagtggatggcggccgaggatccgctg
tttatgctgtacaccagtggatcaacgggcaagcccaagggtgtgcttcacaccacggct
gggtatcttctgtacgccgccacgacctttaagatcgtttttgactacaagccgcacgac
gtttactggtgcaccgccgatattggttggatcaccggccacacgtacgtgctgtacgga
ccgctggccaacggtgccacctcggtcatgttcgagggtagtccattcttcccggagaac
gatcgctactgggaagttgtggacaagtacaaggtcacgcagttctacacggcaccgacg
gcgatccgatcgctgatgaagtacggcgatgagccggtcttgaagcatgatctgtcgacg
ctgagagtcctcggaagtgttggtgaaccaatcaacccggaggcatggatgtggtactac
aaggtggtcggcaaggaaaagtgctcgatcgtggacaccttctggcagacggagaccggc
ggacacgtgatcaccccattgccgggagcaaccccaatgaaaccaggatctgctagcttc
ccattctttggcgtgaaaccaaccctgctggacgaaagtggtaacgaggtcaagggagaa
ggtgagggttacctcgtgttttctcaaccatggcccggcatgatgaggaccttgttcaac
aaccatccccgctacgagtcaacgtatttctccaagtttaacggattttactgcaccgga
gacggtgctcgacgtgacgccgatggatactactgggttaccggtcgcgtcgacgacatg
ctgaacgtttccggccatctcatgtcgacggccgaggtcgagtccgtactgacggagcac
acgcgggtgtcggaagccgccgtcgtgtcccgaccacaccccgtcaagggtgaatgtctc
tactgcttcatcacgcccaaccagaacgaagtgtttgacaaaaccctgatcaacgaactg
aaggttctcgtccgggaacggattggtccgttcgcccagccggacgtgatccagcacgcg
ccgggacttccgaagacacgctccggcaagattatgcgacgagtgctgcgcaaggtggcg
gtcaacgatcgcgaaatcggcgacacttcgaccctggcggacgaagcgatcatcgagcag
ttgtttgccaaccggccggtagcttaa

DBGET integrated database retrieval system