KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016647Help
Entry
CpipJ_CPIJ016647  CDS       T01079                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpipJ_CPIJ016647
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpipJ_CPIJ016647
   00020 Citrate cycle (TCA cycle)
    CpipJ_CPIJ016647
   00620 Pyruvate metabolism
    CpipJ_CPIJ016647
Enzymes [BR:cqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CpipJ_CPIJ016647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 512 aa AA seqDB search
MLRTIAVRNERLLLQGSRKAVLRDTASRALSCEAVRRNAVQKNAQRWTSITSSNAGPKVT
LQVSFVRGYCSSYPEHSKVMLPALSPTMELGTIVSWEKKEGDKLNEGDLLAEIETDKATM
GFETPEEGYLAKILVQAGQKDVPIGKLVCIIVENEADVAAFKDYKDTGAPAAAPAAAAAP
PPPAAAPPVATPPPMAAAPPPPPAAPAAAAPLTAVEQRGPRVYASPMAKKLAEQQRLRLE
GRGSGLFGSLTSKDLAGMQAAGAPAAAHAPAAGPAKIPAGAAYVDLPVSNIRGVIAKRLL
ESKTTIPHYYLTVDCNMDQINKLRAKFNKQLEKDGVKLSINDFIIKAAAMACKKVPEANS
AWMDTVIRQFDAVDVSVAVSTDRGLITPIVFGADRKGLADISKDVKSLAAKARDGKLQPQ
EFQGGTFSVSNLGMFGVTHFCAIINPPQSCILAIGGTQKRVVPDKDSEQGWKESDFVAVT
LSCDHRTVDGAVGARWLQYFRQFLEDPHSMLL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaaccattgccgtacgaaacgagcgactgctgcttcagggttcgcggaaggcg
gtactccgtgatacggccagccgggcgctcagctgtgaggccgtccgccggaatgccgtg
caaaagaacgcccaacgatggaccagcatcaccagcagcaacgccggtcccaaagtaacc
ctgcaggtcagctttgtccgcggctactgcagcagctatccggaacactcgaaggtcatg
ctgccggccctatcgccaaccatggagctgggtacgatcgtcagctgggagaagaaggaa
ggcgacaagctgaacgaaggtgacctgctggcggaaatcgaaaccgacaaagccaccatg
ggcttcgagacgcccgaggagggttatctggccaagattttggtgcaggccggccagaag
gacgttccgattggcaagctggtgtgtatcatcgttgagaacgaggccgacgttgcggcg
ttcaaggattacaaagacaccggagccccggccgcggcaccggcagcagctgccgctccg
ccaccgccagccgcggctccaccggtagccactccaccgccaatggctgcggcacctccc
ccaccaccagcggcaccggcagcggccgctccgttgaccgccgttgaacagcgtggcccg
cgagtctacgccagtccgatggcgaaaaagctggccgaacagcaacgactgcgattggaa
ggtcgtggctccggcctgttcggctcactaacgtctaaggatcttgcaggtatgcaggcc
gccggcgctcctgcagccgcccatgcacctgccgcgggcccagccaagattccggcgggg
gcggcctacgtggaccttccggtgtccaacatccgtggtgtgatcgccaagcggctgctc
gagtccaagacgaccattccgcactactatctgaccgtggactgcaacatggaccagatc
aacaagctgcgcgccaagttcaacaaacagctcgaaaaggacggcgtcaagctgtcgatc
aacgactttatcatcaaggcggccgcgatggcctgcaagaaggtcccggaggcgaactcc
gcctggatggacaccgtcatcagacaatttgacgccgtcgacgtgtcggtggcggtctcg
accgatcgtggcctcatcactccgatcgtgttcggcgcggaccgcaagggactggccgac
atctccaaggacgtgaagtcgctagcagcgaaggctcgcgacggcaagctgcagccgcag
gagttccagggcggcaccttcagcgtgtccaacctgggcatgttcggcgtgacgcacttt
tgtgccatcatcaacccgccccagagctgcatcctggccatcggtggcacccagaagcgc
gtcgtacctgacaaggactcggaacaaggctggaaggaaagcgactttgttgcggtgacc
ctgagctgtgaccaccgcactgtggacggtgccgtcggtgcccgctggctgcagtatttc
cgtcagttcctggaagatccccactcgatgctgctgtaa

DBGET integrated database retrieval system