KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016671Help
Entry
CpipJ_CPIJ016671  CDS       T01079                                 

Definition
chromatin regulatory protein sir2
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     CpipJ_CPIJ016671
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 339 aa AA seqDB search
MGMGQCILVWLELGFTPTRFGVHTGAGISTSAGIPDFRGPNGVWTLEKRGEKPTVNVAFD
EAIPTATHMGLKALVEAGHIKYVVSQNIDGLHMRSGLQRKNLAELHGNMFIEQCLKCRRQ
YVRATPAPTVGKKLTGDVCRGTKNSRACRGGNLIDNILDWEHDLPESDLDLSFMHSTLAD
LNICLGTTLQIVPSGNLPLRNKRYGGRLVICNLQPTKHDKKADLIISTYVDTIIQKVAKK
LGVEIPAYTPDMDPTKEKPTTSLEWTIPTDEVKALDKIYAKTVKELAKTKKKTASSARDE
KEEFKLKAKKLKKDTSGEGALGANIEAKLICTRSRYLSR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgggccaatgcattctcgtctggttagaattaggttttacgccgactcgattt
ggagttcatacgggagctggcataagtacaagcgctggcattccggactttcgcggacca
aacggtgtctggacgctggagaagcgcggtgagaaacccacggttaacgttgcctttgac
gaggccatccccacggccacccacatggggctgaaggccctggtggaagctggccacatc
aagtacgttgtcagtcagaacatcgacgggctgcacatgcgatccggtctgcagcgaaag
aacctggcagaactgcacggaaacatgttcatcgaacagtgtctgaaatgtcgccgccag
tacgtgagggccacacctgcgccaacggtggggaaaaagcttaccggagacgtctgtcgg
ggaaccaaaaatagccgagcctgccgcggaggcaacctgattgataacattctggactgg
gagcacgacttgccggaaagcgatctggatttgtcgtttatgcactccactctggcagat
ctgaacatttgcctcggaaccacgctgcaaatcgtccccagtgggaatctgcccctgcgg
aataaacgctacggcggacggttggtcatttgcaacttgcaaccaacgaagcatgacaaa
aaagccgatctcataatctcgacgtacgtggatacgatcatccagaaagtggcgaaaaag
ctgggcgttgaaatccccgcctatacgcccgacatggatcccaccaaagagaaaccgacc
acgagtcttgagtggaccataccgacggacgaggtaaaagcgctggacaagatttacgcc
aaaacggtcaaagagcttgccaagacgaagaaaaagacggcgagttctgctcgggatgaa
aaggaggagtttaaattgaaggccaaaaagctgaaaaaggatacctcgggtgaaggagcg
ctgggtgcaaatatcgaagcaaagctaatttgcacccgatcgcggtacctgtcgcggtag

DBGET integrated database retrieval system