KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016898Help
Entry
CpipJ_CPIJ016898  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CpipJ_CPIJ016898
Peptidases [BR:cqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CpipJ_CPIJ016898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1198 aa AA seqDB search
MKILPFEITFAKCDAWDRNFELAPSIGEPCSECEANGPNLWICLQKNCLHIGCSEQYNDH
STTHYQQQRSHCIHMNLSSQRIWCYLCEFEVFLVQQQQQQQQLRRTSVVSNDSSDASRYS
ATANEKLLMYGGGGGGGGGGESCDSSCEEDEFEKHGKWNGLVGLQNIANTCYMNSAIQAL
SNSPPLTGYFLDCGSIIETDLLGNQTVSKPGLAKHYHKLIKEMWCKNRRYVVPSGILYGI
RIVHPMFRGYQQHDTQEFLRCFMDQLHEELKEVTQQQPPDLLSLQDRNGDPDISPCPSPS
PSQSEAEYETCDSGVSEQSSLSDDVSINSKRTRMVSRSPSPGQRPVQSPHSRQQSPIGSN
RSNSSSSGSMTSQQQQNQQPNDSQQKQKQTKDKLPERSIISDIFDGKLLSSVQCLTCDRV
STREETFQDLSLPIPGKDHLAVLHQNHPGMQASPPPHPHPHPHPPPTAGSSTGITCSDAV
YPVSGDSWMWWFWNWPFWSWIRSWFWGPAVSLHDCMAAFFSADELKGDNMYSCEKCNKLR
NGVKYSRVLALPEMLCVHLKRFRHDLSYSSKISSPVHFPLNGLDMRPYLHKDCKSEVTSY
DLCAVICHHGTVGGGHYTSFAKHDPTGKWFEFDDQLVTHVSPEDVQNCEAFNTFAEPGPI
DNWTLLCPHGAFPPNKAPYFAKLVVPIPQPLWDFLYKKFGGGPVCNHIFPCHICKKAAES
LSRRQRAELEAFTACNDEYQYNETPTTIYAISMAWFRQWQLFARGVTTDEPGPIDNKTVA
VPGDTAVPLRSVRQGSDYAQINSTLWHFFHGIYGGGPEIVLRGNPVPPPEPKVQKVVKER
DVEPMDVSEPAPPPSKTPSMASGRTQDSAIDVTISEIPPPTSAATTSTQKPQKSVSFEDN
EGYAETDGDQQHEAVASSRSSSVQLKRKQMKLQKEQQQQQQQSKESKKNGSEQDGSGDGG
GLVNTYLRRKQLKQQQQVTAGAAGAGDVGGAGGVVDTLEIGGKKDRRHRAGMKTNGFFGP
EGKYQPSSSDGIPRTGSFSQPSTAATKPSTFATLTSSASATVFSKSADDSHIAVTTTNGS
TESSSSVGGGDASKSVDEIMPLLHQTSITGAGPDGVGDGGVEAGDESDAADGPMPMVKHG
RKGHGHHGQDRGMMAFSRKKLKTKYMKSKAASKGGGVVVLDGVAGTMTNGGVASDGEK
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atgaagatattaccgtttgaaataacgttcgccaaatgtgacgcttgggatcgaaatttt
gaactggcccccagtataggcgaaccatgctcggagtgcgaggcgaacgggcccaacctg
tggatttgtctgcagaagaactgtctgcacattggctgctcggagcagtacaacgaccac
agtacgacccactaccagcagcagcgatcgcattgcatccacatgaacctgtcgtcgcaa
cggatctggtgctatctgtgcgagtttgaggtgtttttggtccagcagcaacagcagcag
caacagttgcggcgaacgtcggtcgttagcaatgattcgagcgatgccagccggtactcg
gcgacggccaacgagaagctgttgatgtacggagggggaggcggaggtggaggtggggga
gagtcctgcgacagtagctgcgaggaggacgagtttgagaagcatggcaagtggaacgga
ctggtcgggctgcagaacattgccaacacctgctacatgaactcggcgatccaggcgttg
agcaacagtccgccgttgacggggtacttcttggactgcgggtcgatcatcgagacggac
ctgttggggaatcaaactgtgtcgaagccgggcctggccaagcactaccacaagctgatc
aaggagatgtggtgcaagaatcgtcgttacgtcgtcccaagtggcattctgtacggcatc
cggatcgtccatccgatgttccgcggctaccaacagcacgacacgcaagaattcctgcgc
tgcttcatggatcaactgcacgaagagttgaaggaggtcacccagcagcaaccgcccgat
ctgttatcgctgcaggaccgtaacggcgatccggacatttcaccatgtccttcaccttcg
ccctcccaatcggaagccgagtacgaaacgtgcgacagtggcgtctccgaacaatccagc
ctgtcggacgacgtctcaatcaacagcaaacgcaccagaatggtgtcgcgatcgcccagc
ccaggccaaagaccggtccaatccccgcacagccgacagcaatcccccatcggcagcaac
cggagcaactccagcagcagcggcagcatgacctcccaacaacaacaaaaccagcagccc
aacgactcccaacaaaagcaaaagcaaaccaaggacaaactgcccgagcgatccatcatc
agcgacatcttcgacggcaagctgctttcctccgtccagtgtctgacctgcgatcgcgtc
tcaacgcgcgaagagacattccaggacctgtccctcccaatccccggcaaggaccaccta
gccgttctccatcaaaaccaccccggaatgcaagcctcccctcctccccacccacaccca
cacccgcacccacctccaaccgccggaagcagcaccggcataacctgctcggacgccgtc
taccccgtgtccggcgacagctggatgtggtggttctggaactggcccttctggagctgg
atccggtcctggttctgggggcccgccgtctccctgcacgactgcatggcggccttcttc
agcgcggacgaactcaaaggcgacaacatgtacagctgcgaaaagtgcaacaaactgcgc
aacggcgtaaagtactcccgcgttctagccctgccggaaatgctgtgcgtccacctgaaa
cgcttccggcacgacctctcgtacagctcgaaaatatccagccccgtgcacttccccctc
aacggcctcgatatgagaccgtacctgcacaaggattgcaagtcggaagtgacctcgtac
gatctgtgcgccgtcatctgtcatcacggaaccgtgggcggaggccactacacgagcttt
gccaagcacgatccaaccgggaagtggttcgagtttgacgatcagctggtgacgcacgtc
agcccggaggacgtgcagaactgtgaggccttcaacacctttgccgagcccggccccatc
gacaactggacgctgctctgcccgcacggagcgtttcccccgaacaaggcgccgtacttt
gccaaactggtcgtgcccattccgcaaccgttgtgggactttttgtacaaaaagttcggc
ggcggccccgtctgcaaccacatcttcccgtgccacatctgcaagaaggccgccgagtcg
ctttcacggcgccagcgggccgaactggaagcgtttaccgcgtgcaacgacgagtatcag
tacaacgaaacgccaaccacgatctacgcgatctcgatggcgtggttccgccagtggcag
ctgttcgcgcggggcgtcacgacggacgagccgggaccgatcgacaacaagacggtcgcc
gtgccgggcgatacggccgtcccgctgcggagcgtccgccagggctccgattacgcccag
atcaactcgacgctgtggcatttcttccacggcatttacggcggcgggccggagattgta
ctgcgcgggaatcccgttccgccgccggaaccgaaggtgcagaaggtcgtcaaggaacgc
gacgtcgaaccgatggacgtgagcgaaccggcaccaccgccttcaaaaaccccgtcgatg
gccagtggccgcacgcaggattcggccatcgacgtgacgatttccgagataccaccgcca
acttccgctgcgacaacctcaacccaaaagccccagaagagtgtctcgttcgaggacaac
gaaggatacgccgagacggacggcgatcagcagcacgaagcggtggcctcctcgcggtcg
tcgtcggtgcagctcaagcggaagcaaatgaagctgcaaaaggagcagcaacagcagcag
cagcagtccaaagagtccaaaaagaatggaagcgagcaggatggttctggggatggcggt
ggattggttaatacgtatctgaggaggaagcagctgaagcagcagcagcaggttacggcg
ggtgctgcaggagctggggatgttggaggggccggtggtgtggtggacacgctcgagatt
ggaggcaagaaggatcggcggcatcgggcagggatgaagacgaacgggttcttcgggccg
gaaggcaaataccaaccatcctcgagcgacggcatcccgcgcaccggttcgttctcccag
ccatcgacagcagccaccaaacccagcaccttcgcgaccctcaccagctcggcatcggcc
acggtgttctccaagtccgcggacgactcccacattgccgtcaccaccaccaacggttcc
accgagtcgtcctcctccgtcggcggcggcgacgcgtccaaatccgtcgacgaaattatg
cccctgctgcaccaaacctccatcaccggagctggtccggacggcgtcggcgatggtggt
gttgaggccggcgacgaaagcgacgccgcggacggaccgatgccgatggtcaaacacggt
cgcaagggtcacggtcaccacggtcaggatcgcggcatgatggcgttcagcaggaagaag
ctcaagaccaaatacatgaagagtaaggcggcctcgaagggcggcggagtggtggtgctc
gacggggtcgccggaacgatgaccaacggtggagttgctagtgatggagagaaatga

DBGET integrated database retrieval system