KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ016911Help
Entry
CpipJ_CPIJ016911  CDS       T01079                                 

Definition
beta-hexosaminidase beta chain
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CpipJ_CPIJ016911
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CpipJ_CPIJ016911
   00603 Glycosphingolipid biosynthesis - globo series
    CpipJ_CPIJ016911
   00604 Glycosphingolipid biosynthesis - ganglio series
    CpipJ_CPIJ016911
   00511 Other glycan degradation
    CpipJ_CPIJ016911
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CpipJ_CPIJ016911
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CpipJ_CPIJ016911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 534 aa AA seqDB search
MKLVTSLVTFWLVLNCVSCSFVVEPGPAVKATRGEIWPKPKVQSSTENYFGIDPVTFQFK
VTGHTCDILDKAIERYYGIVFSVANDFGSTETNAINSRNLFAKQATLDYSNFFGFLDEVE
VHLKEPCEEWPYFEMDESYRISLNKFEYKLQSSTIWGILRALESFSQMVISWSGMLRINS
TLIMDRPRFPHRGLLVDTSRHFISLPILLQILDGMAYNKLNVFHWHIVDDQSFPYHSVKF
PELSEKGAYHRSMIYSPEDVQTVLEEARLRGIRVMPEFDTPGHTRSWGESHPELLTPCFG
KLGPIDPTKESTYAFLSELFQEVTGVFPDRYFHLGGDEVAFDCWQSNSDITEFMDDNQIV
DYGILQARFTRRVVDLVDRLNKSSLVWQEVYENADNLPDGTVVQVWTGDQKQLLKQITGD
GLPALLSACWYLDHLSWGGDWQKFYNCEPRAFPGTQDQKKLVMGGEACMWGEVVNDRNIL
QRIFPRVSGVAEKLWSQRNVNDTVEAAARLEEHVCRMNRRGIPAQPPNGPGYCL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgttacaagtttggtgacattttggttagttttgaattgcgtgtcctgttca
tttgtggtcgagccaggaccagcagtgaaagctacacgaggtgaaatttggccgaaacca
aaagtgcaatcatcgaccgaaaattactttggcatagatccagttacgtttcagtttaag
gtcaccggtcatacgtgcgatattctggacaaggcaatcgaaagatattacggaattgtg
ttcagtgtggcgaacgattttggcagcacggaaaccaatgcgatcaattcgagaaatttg
tttgccaagcaagcgacgttggattattcaaatttctttggctttctagatgaagtagaa
gttcacctaaaagaaccctgtgaagagtggccctattttgaaatggatgagtcgtatcga
atatccttaaacaaatttgagtacaaactacaatcgagtacaatttggggaatccttcgt
gctttggaatcgttctcgcaaatggttatatcttggagtggaatgttgcgaattaactcg
acccttatcatggaccgaccaaggtttcctcaccgaggtcttctggtggacacttctcgg
cacttcatatcgctcccaattctccttcaaatcctggacggcatggcgtacaacaagctg
aacgtgttccactggcacattgtggacgaccaaagttttccttatcatagtgtgaaattt
ccagagttgagcgaaaagggggcctaccatcgatcaatgatctacagccccgaggacgtt
caaactgtactggaagaggctcgcctgcgaggtattcgggttatgccggaattcgacact
cccggccacactcgatcatggggagaatctcatccggagctgctgactccttgctttggc
aaacttggacccatagatcccacgaaagagtccacctacgcgttcttgtccgagctgttc
caagaagtgaccggagtgttccccgatcgatacttccaccttggtggtgacgaagtggcc
ttcgactgttggcaaagcaattccgacatcacggagttcatggacgacaaccagatcgtc
gattacggaatcctgcaggcacgcttcacccgacgggtcgtcgatcttgtagacagactg
aacaaaagctcactagtctggcaggaagtgtacgaaaacgctgacaaccttcccgacgga
accgtcgtccaggtttggaccggcgatcagaagcaactgctcaagcaaatcaccggcgac
ggccttccggcactactatccgcctgttggtacctggaccacctcagctggggtggagac
tggcaaaagttttacaactgtgagccgcgggccttccccggaacgcaggaccagaagaaa
ctggtgatgggcggagaagcgtgcatgtggggtgaagtggtcaacgatcggaacattctg
cagcggatctttccgcgagtgtcgggagttgcggaaaagttgtggtctcagcggaatgtg
aacgacaccgtggaggcggcagcgcggcttgaggaacatgtttgcaggatgaatcgacgg
ggtattccggcgcagccaccgaatggaccggggtattgtttgtga

DBGET integrated database retrieval system