KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ018501Help
Entry
CpipJ_CPIJ018501  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CpipJ_CPIJ018501
Enzymes [BR:cqu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CpipJ_CPIJ018501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 1031 aa AA seqDB search
MICVINRTVIYRYLRVFDRNAGFVIEACYRYSLEGQKGAKICSTKRWLKHEKIECLVGCI
AELTEKEEAALLQPGRNDFSVMYSCRKNCAQLWLGPAAYINHDCRANCKFVATGRDTACV
KVLRDIEIGEEITCFYGEDFFGDNNRYCECETCERRGTGAFAKDKNGEDQQSPNGVRYRL
RETDNRLNRLKSKNSPVAENGKTSIGKSEPPSALAALSMKELREKGMTKYDAEMLLASTQ
QKSSPFEGNHVPEASEEPTTTTSVVPTATQEDNNKRATRSSRRFQQTPTTSEGVGPRRFS
SNSSLNTDISSVLSSTSSFVTAKSTCSVPTAAERKMMPREDAEVKSSAVIVIDDDHNSCH
SYASKASSSTSTSKSNVYVFNDLLDGGGEGADGAPLNGYTLRNHHQCSKDVPTAVVPAST
KRRSARAPEVVSPRVTRTRKQRLLMKVEEPPQTTPSSKDLASSASTTPGSGDSSNRGNRR
KQKLQTRTLQADEEAALQKQVLEAAASEQPDLLRLVPRRLVLGGEGEEEEDDEDDVILSN
CVTNCDVASSDKLVPDVIVLSSGVSSSSGSSSCGSESRCNSVGKGEGEQSQQLEQVPEEQ
GELASKLVIGSRKRKVSKSVSESESSSSWENKVPQRNTGNIPNPEALLKTPERRLKLTLR
MKRSPVIDEIIESGTSLSEDTCSTSNFKPEYEILRVEGIAEESDKDEDDDGDDDGGGGGD
DDDELTYSSSCSSRLSQKRKKRHKSKEARRHRKRVKRELRRHNHHHHHHQELDGAGQPPQ
QPSVILQPSALGPVTAAMAAAARTPPKHSPQAFPAPTKRLRLIFGNETRTIDIPPTAKIS
AASSSSSPSTTGSTSTSSSAPSSLPLSPVTSLTPNNPTNSSAAVVAVSINNTPGVIVSPT
RVVHHHHPQTQFPAFNGYYNPLSTTFQQFSHHSHPHHHHHNLFAFQTQPTATVESQQPAA
QHPPPQAAAVIQHTAQLQNPYHHQYHHHHLTAVTTPTKCSPYGQAIGGGAGGGGGGSVLT
TAPVGGTLSFN
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtgttatcaataggaccgttatctaccgctacctccgcgtgtttgaccggaac
gccgggttcgtgatagaggcctgctaccgctactcgctcgaaggtcaaaagggcgccaag
atctgctcgaccaagcggtggctcaagcacgaaaagatcgagtgcctggtcgggtgcatc
gccgagctgacggagaaggaggaggctgcgctgctgcagcccggccggaacgactttagt
gtgatgtacagctgcaggaagaactgcgcccagctgtggctgggacctgcggcgtacatc
aaccacgactgccgggcaaactgcaagtttgtggcgaccggacgggacacggcctgcgtc
aaagtgctgcgggatattgagattggcgaggagataacctgcttttatggggaggacttc
tttggggataataatcggtactgcgagtgtgagacttgcgagaggcgtgggacgggggcg
ttcgccaaggacaagaacggcgaggaccagcagagcccgaacggggtgcggtacaggttg
cgggaaacggacaaccggctgaaccggctcaagagcaaaaatagtccggtggcggagaat
ggcaaaaccagcatcggcaagagcgaaccgccctcggccctggccgcactcagcatgaaa
gagttgcgcgaaaagggcatgaccaagtacgacgccgagatgctgctggcgtcgacccag
caaaagtcgtcccccttcgaggggaatcacgtgccggaggcgagtgaggaacctacgacg
acgacgagcgtcgttccgacggcgacccaggaagacaacaacaaacgagccacccgttca
tcgcgacgatttcaacagactccgacgacgtcggagggcgtcggtccacgccgcttcagc
agcaacagcagccttaacacggacatttccagcgtactctcgtcgacgtcctcgttcgtg
acggccaaatcgacctgctccgtgccgacagccgccgaacgcaaaatgatgccccgcgag
gacgccgaagtcaagtcgtccgcggtcatcgtcatcgacgacgaccacaacagctgccac
tcgtacgcgtccaaagccagcagcagcaccagcaccagcaaaagcaacgtgtatgtgttc
aacgatctcctggacggtgggggcgaaggcgccgacggcgcccccctcaacggctacacg
ctccgcaaccatcaccagtgcagcaaggacgttccgacggcggtggttccggcttcgacg
aagcgacgatctgcgcgcgctccggaagtggtcagcccaagggttacgcgaacgcgcaag
cagcggctgctgatgaaggttgaggaaccgccgcagacgactccgtcgtcgaaggatctc
gcctcgtcggcgtctacgacgcccggcagtggggacagctcgaaccggggcaatcgccgc
aagcagaagctgcaaacgcgaacgctgcaggcggacgaggaagcggcgctgcagaagcag
gtcctggaggcggcggccagcgagcagccggatctgctgcggttggttccgcggcggctt
gtcctgggtggtgagggggaagaggaagaagacgacgaggacgatgtgatcctgtcgaac
tgtgtaaccaattgtgatgtagcgagtagcgataagttagtgccggacgtaattgtgctg
agcagtggagtcagcagcagtagtggtagcagtagttgtggtagtgagagtagatgtaac
agtgttggcaagggtgagggggaacagtcgcagcagctggagcaggtcccggaggagcag
ggggaacttgcctcgaagttggtgattggttcgcgcaagcggaaagtgtccaaaagtgtg
agcgagtcggagagcagtagcagttgggagaacaaggtcccgcagcggaacaccggtaac
attccgaacccggaagcgcttctcaaaacgcccgagcgacgactcaagctgacgctgcgc
atgaagcgcagtccggtcattgacgaaatcatcgaatcaggtacgagcctcagcgaggac
acttgcagtaccagcaactttaagcccgagtacgagattctgcgcgttgagggcatcgcc
gaggagtccgacaaggacgaagacgacgatggtgatgatgatggcggcggcggtggagac
gatgacgacgagctgacctacagcagcagctgcagcagtagactgtcgcaaaagcgcaag
aaacgccacaaatcgaaggaagcccgaaggcaccggaaacgggtcaaacgggaacttcgc
cgccacaaccatcatcatcatcaccatcaagagctggacggcgctgggcagccaccccag
caaccttcagttatactgcaaccttccgcgctgggaccggtcacggcggccatggccgct
gccgcccgaactccccccaaacactcgccacaggcatttcccgcgccaaccaaacggttg
cggctcatcttcggcaacgaaacccgcacaatcgacattccaccaaccgcaaagatctcc
gccgcgtcgtcgtcgtcgtcgccctcgacgaccggctccacctccacctcgtcctccgcc
ccctcctcgctgccactctcccccgtgaccagcttaacgccaaataacccaactaacagt
tccgccgccgtcgtcgccgtcagcatcaacaacacgcccggggtcatcgtgagtccgacg
cgggtcgtccatcaccaccacccgcaaacccaattccccgcgttcaacgggtactacaac
ccgctgtcgacgaccttccagcagttctcccaccactcccatccccaccaccatcaccac
aatctgtttgcatttcaaacgcagccgacggcgacggtcgaatcccaacaacccgccgcc
caacatccgcctccacaagccgccgccgtgattcagcacacggcccaactgcagaatccg
taccatcatcagtatcaccatcatcatctgacggcggtgacgacgccgaccaagtgcagt
ccgtacgggcaagcgattgggggcggggcggggggagggggaggtggcagtgtactgacg
acggcgcccgttggtgggacgttgtcgttcaactga

DBGET integrated database retrieval system