KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ018519Help
Entry
CpipJ_CPIJ018519  CDS       T01079                                 

Definition
hypothetical protein
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 774 aa AA seqDB search
MRENSDDVSPHVWKEWILEAIRRIRCQKQRPSVQRICQAIGSHHKFHEDIVAEKLEEAVE
AGAVLKVYNKGLHSYKAPTNTQRRVTAVTNSSDLSRLVAKAVRDLGECDGSTLKSIENYV
QQTNNLNIMSDTDYNQVIKSSIRIALAEGSVVQEGKLYKLGSSAKNVVKRKSNSPKKRDK
PSNEIPAKKSTNTVCVECLGTDTKGPAGGPEPLSSCNGCGMSLHNKCASGDSDLVPPLSV
LVTRGNKWFCEECRSCDACATQNERGPCVLSCGNCPKAFHFSCMDPGLSDLKKVKTIWRC
VVCLNNYNKTAKAEVGSPSIETQIRKLPEALEEKRKKKSTQDRHVQQGAQPVDLNQTPTA
RHSGASVKSSSKASGAKISNVRRIKQPQLSSPESPERKEELPDFNLSDSSSESSSSDNED
DNYSSSESCTSSSNSNDLSGDSSSDELELKTNNNCDKMQTNPAISGSVNTMDSRIIASQA
SSKSVMTSQNTAALAFGSNMFSSNESWGFAAEAKKNIDIFCPKSSSDPKQLTTSIGLPAA
SVLSDKKNRLNVKPRKKDTPTANCNLFQTVASATNVAVLGERHFQKTQNASTDTLSAGSS
FKETSKCVEKSLKSSKQKASALNLKHESKKTTETCNKSTILSRCFSSLKNNQQQAIKDNY
NLFMRSIGEEGMPDKLSPSKLVKKAINEKHFDQHKKRNLTKTDPQTQKMFNTAKLKALEG
DNSELLTGEAPTANKQKTKSSFATDSVGKAATESLHHPSSSRIGKIYQINMTND
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaaacagtgacgacgtcagtccgcacgtgtggaaagaatggatcctcgaggcc
atacggcgcattcggtgccagaagcagcgcccgagtgtccagcgaatctgccaggcgatc
ggcagccatcacaagtttcacgaggacattgtggccgagaagctcgaggaagcggtggaa
gcgggcgccgtactgaaagtatacaacaaaggattgcactcctataaagcaccaaccaac
acacaacgtcgtgtaacggcagttacgaacagcagtgatctgtcacgtttggtagcgaaa
gcggttcgtgacctgggcgagtgtgatgggtcgacgttaaagtcgatcgaaaactacgtt
caacaaacaaacaatttgaacatcatgtctgacacagactacaaccaagtaatcaaaagt
tcaatccggattgcacttgccgaaggaagcgtggtgcaggaaggcaaactgtacaagctt
ggtagttctgctaaaaacgtggtcaagagaaaatcaaactctcccaaaaagagagacaaa
cccagcaatgaaattcctgcaaagaaatcaacaaacaccgtgtgcgtcgagtgcctcggc
acggacacgaaaggtccagcgggcggtccggaaccactcagttcttgtaacgggtgcggc
atgtcgctgcacaacaagtgtgccagcggcgattccgacctggttccgcccctttccgtg
ctggtgacgcggggcaacaaatggttctgcgaggaatgtcgatcctgtgacgcttgcgca
acgcagaacgaacgtgggccgtgcgtgctgagctgtggtaactgccccaaggcgttccac
ttctcgtgcatggatcccgggttaagtgacttgaagaaagttaaaacaatctggaggtgc
gttgtatgtttgaacaattacaacaaaaccgccaaggcagaggtcggttccccaagcatt
gaaacacaaatccgaaagttacctgaagcattggaggaaaaaagaaagaagaaatcaaca
caggataggcacgtacagcaaggagctcaaccggtcgatttgaaccagactccaacggcg
cgccattcgggtgcgtcggtcaagtcatcatctaaagcgagcggtgctaaaattagtaac
gttcgtcgtattaagcagccccagttatcatctcccgagtcgccggagcggaaagaggaa
ttgcctgatttcaacttgtccgattcgtcctcggaatcgtcaagtagtgataacgaagac
gataactattcctcaagtgagagttgcacgtccagctcaaacagtaatgacttatccggg
gacagttcgtccgatgaactcgagttaaaaactaacaacaactgtgataaaatgcaaaca
aatccggcaatatctggtagtgttaataccatggacagtagaataatcgcatctcaagcg
agctcaaagtcggtaatgaccagccagaacacagcagcactggcgttcggcagtaatatg
tttagcagcaacgaatcgtgggggtttgcggcggaggctaagaaaaatattgacatattt
tgtcccaaatcatctagcgacccaaagcaactgactacgagtatcggcttaccagcagcg
tcggttctgtcggataaaaaaaatcgtctaaacgttaaaccgagaaaaaaagatactcca
acggcaaattgcaacttgttccaaaccgtagcgtccgctactaatgtagcagtcttagga
gaaagacattttcaaaagacgcagaatgcatcaactgacactctgtccgcaggatcctcg
ttcaaagaaacgtccaaatgtgtggaaaagagcttgaaatccagcaaacagaaagcatcg
gccttaaatttgaaacatgaaagcaagaaaacgacagaaacttgcaacaaaagcacaatt
ttaagccgctgcttttcatcgttgaaaaacaaccagcagcaagccatcaaggacaattac
aacttgttcatgagatccattggagaggaaggaatgccagacaagctatccccgagcaag
cttgttaagaaagcgatcaatgaaaaacactttgaccagcacaaaaagcgaaacttaacg
aagactgacccacaaacgcaaaaaatgttcaacaccgccaagttgaaagctctcgaaggc
gacaatagtgaacttcttacaggcgaagccccaacagcaaacaagcagaagacgaaatct
tctttcgccacagattcggttggaaaagctgcgacagaatccttgcaccatccatcttcc
tctcgaattggtaagatatatcaaattaatatgacgaatgactaa

DBGET integrated database retrieval system