KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ018676Help
Entry
CpipJ_CPIJ018676  CDS       T01079                                 

Definition
phospholipase c epsilon
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CpipJ_CPIJ018676
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CpipJ_CPIJ018676
Enzymes [BR:cqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CpipJ_CPIJ018676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 2067 aa AA seqDB search
MREAFPGLPFNSNVAAEKLLLSTLSAPLDQTVHLKEQKVNNKLRHSTVSPLTVSLSSSSL
SSNATVASNSAATSHKHGPGIVITEKIINNSQGETIEEALVDTESEKNVVLDSHSAQSNV
GNLPSTVVQAGTAVATTTTTSNAGTSSTTPSFGELDELHSILHFPEEVALRITDTEYHLF
YQVLPNDFINDAILELQKEQTFKTSNQNHTSLSTTSVSCSNNNVSRTQEPKDSSSVNGIG
TADSTAITADTHSEYQSSLSSIRKRFEETSAWTNYFVLSQGTQDERKAAFACLLRVAISC
WNIGNFNGAKEIVDGLKSIKRESIWSSEAERARNSAFEFLTNVFDSNEYENALSRALAIS
TCRTVPYFKNHINELKKLLRAVPESLHDGDDDDVQCQQDRYYLGETKQILQEDDEEMLLR
LSQVELPLKHPETSTSSESPTVDNLEQTIYQRVQPAFKTILACVSHHQSLCRELPHSLQE
FLRTAANSPRQTKIPLYQPSNLQELEEDYEVEIGNYNPVQPLFYDHGVSIVPLSTKKSNV
VDHHILQILHHGTTAVLWEPEIPAERSTFVYLRLERSCSCISWQRTAWRRIKSQQDINPN
QNPEENVTWRFASRCTSNIGDVEVQSQNLEEGILDLGTVKDIAMGSRNHEYDHDILAAGK
RFGLTHVESCISLLYGNSASENRFLCILCPPLLCRTWFIGLHWMLRGFRRQQSLIDRSML
WLKELYIQLYYEEGMCSEPTVSDAIKAFGGQLYLSSMKSLSRTQINDSTPELVATTTAAT
ANKKDCNSKIRKKRSMANLLNQSTVHNSSISATDPCISDLEKSRLNDKKRDRYDSQDQLC
QNMKKLNIGSVTQDTQLDFLSFVTLYRSFSILIRHDLQDIFNQLAVASMSRATLNGEKSR
SAPELSEMAVKRLLTRNCSLDLESSDAKHTRKRHFDTIAASSIAVKNDHIISSNKVITLA
TLKKFLETRQMELLNDEDVKTIIQRHEPEAAHRIENCMSFEGFARYMMDKDNYAFLSELM
PESTYMNLPLSQYYIASSHNTYLTGHQLKGESSVELYSQVLLTGARCVELDCWDGEDGTP
VIYHGHTFTTKIPFRAVVDAINKAAFVQSAYPVILSIENHCSVVQQQRMATIFQSIFGEK
LVTNFLFDYDYTDEPFLPSPLSLKHKILIKNKKLIVEVPATLSTGLTRQNTYKQSNLSSR
ASSIISNTSGNSLNEEFSDDEYEDDDDFDNIDDKTYHVNWGSIEDKSRHSLSHGNISTPT
RQHLQLQHQQQFFQQQQQQQQQHQQHLQQEERSRKRSNQIARELSDLVIYIQAIKYRGLN
PYSPHNSTRANPRQQLKTSGSVVTVGSILKNSSGDTLSLPSSSHLSDSLSLSYDSSMSGS
ESHLPPTTRTRNMPNANHPCYQCSSLNEASAKKLCRKDPLGLIAHTETQLMRTYPAGLRI
DSSNFNPVWFWSFGFQMVALNYQTEDMPMHINKAMFEENNSCGYVRKPDVLWNRSHLMYR
RFNPLEKEFDGLHVTQLVINIVSGQYLHHVANGSTIHVEIELLGIPIDCGRRRTKPIKHN
LFNPVWNETFFFKIMFHDLAFLKFTVYESESIIVAQRVISLKCFRPGYRHVRLRSPTNQP
LHMASLFVYTRVEEEGLDRSYGEIDEQYLQQTRQANRKDIPEDIEPILESKVPLLKRKTF
FCTVYDAVPNNPFTILKITQECTTKDVLVMVLQKMHKQKADISNFILIEEVYTGWEKKDK
RHPPTQRVLDMTEKPLQAQACWKGDGRFILKRIGNDPSSRAWVTSIRRTADARRASIATT
TGGGEAAGGLQAGSTPDDPLALENVDNFLVCVFNVSNDIPYAILRVPIKSTAQDVLAQAL
LKARRLDNPNNFVLVEELNYSNKSNDTMQRILLDDENVYMTQANWKSIGRFVIHERSQLT
PSTIRKTILPIEKISRGFSISRGSSSSSTSVHSLISKSPIQVALSDPTTSRIKCRSADVH
GARSKHSHSGPGSGTSIGGRHKYSSEKETSFSSTSSSSNATSKSSNRREVHSEGETLSDE
DVKENDILSTMSRFKRMSIKKLKSWKS
NT seq 6204 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagcttttccgggtcttccatttaatagtaacgttgcagctgaaaaattactc
ctgtcaacgttgtcagcaccactcgatcaaacggttcatctaaaagagcaaaaagtcaac
aacaaattaagacattcaacagtgtcaccgttaacagtttcactgtcatcgtcgtcgttg
tcgtcaaacgcaactgtagcttcaaattcagcagcaacatcgcacaaacacggaccaggc
atagtcatcaccgaaaagattataaataatagccaaggtgaaaccattgaggaagcattg
gtggataccgaatcggaaaagaatgttgtacttgattctcacagtgcacaaagcaacgtt
ggcaatctgccatcaacagtcgtccaagcaggaacagcagtagcaacaacaactacaaca
agtaatgctggaacatcatcaactactccatcattcggtgaactcgatgaattgcacagc
attttgcatttccccgaagaagtggcgttacggataaccgataccgagtatcatttgttc
tatcaggtattacccaacgatttcattaatgacgcaatccttgagctacagaaagagcaa
acatttaaaaccagtaatcaaaatcacactagcctgagcacaacgagcgtcagttgtagt
aataacaacgttagtcgaacgcaagaaccaaaagattcttcatcagttaacggtattgga
acagcagacagtactgcaataacagctgacactcacagtgaatatcaatcatcactgagt
tctatacggaaacggtttgaagagaccagtgcgtggaccaactactttgttctttcacaa
ggtacacaagatgaacgaaaagcggcctttgcatgcctgttgcgtgttgctatttcatgc
tggaatattggaaatttcaatggtgctaaagagatagtggatggtctgaagtcaatcaaa
cgagaatcaatctggtcttcggaagcagaacgagcgaggaattctgccttcgaatttctg
acaaatgtttttgattccaacgaatatgaaaacgctctatcaagggcactggcaatctca
acttgtaggactgttccttattttaagaatcatattaatgagttgaaaaagttgttacga
gcggttccagagtcattacatgatggtgatgatgatgatgtccaatgccaacaagataga
tattatttgggagaaacaaaacagattctccaagaggatgacgaagaaatgttgcttcgg
ttatcccaggtggagctaccactgaaacatcccgaaacatccacttcaagtgaaagtcct
acagttgataatttagagcaaaccatttatcaaagggtacaacccgccttcaaaactata
cttgcgtgcgttagccatcatcaaagtttgtgccgcgagctgcctcacagcttgcaggag
tttctcagaacagcagcaaacagtcctcgtcaaactaaaattcccctgtatcaaccgtcg
aatcttcaggaattggaagaggactacgaggtggagattgggaattacaatcctgttcaa
cctttgttttacgaccacggagtcagcatcgtacctctttctaccaaaaaatccaacgtc
gttgatcatcacattttgcagatattacatcatggaacgacagcagtactgtgggagcca
gaaatcccggcggaacgttctacctttgtgtatctgcggcttgagcgatcatgttcgtgc
atttcttggcaacggactgcgtggcgcagaattaagtctcaacaagatattaatcccaat
caaaacccggaggaaaacgtgacatggcgatttgcatcaagatgtacatccaatataggg
gacgtagaggttcagagtcaaaacttggaagaagggatactagacctgggcaccgtaaag
gacattgccatgggctcaagaaatcacgaatatgatcacgatattctggcagcagggaaa
cggtttgggctgacccacgttgaaagttgcatttccctgctttacggaaattcggccagt
gaaaatcggtttctgtgtattctctgcccaccgttactgtgtagaacttggttcatcggt
ctgcattggatgttacggggctttcggcgccagcaaagtttaatagaccgatcgatgctt
tggctcaaggaactgtacatacaactttactacgaggaaggcatgtgcagcgaacctaca
gtttcggatgcgataaaagcatttgggggtcaactttatctgtcttccatgaaatcctta
tcacggacgcaaatcaacgattcgacgccagaactggttgcgaccaccacggctgcaact
gcaaacaagaaagattgcaattccaagattcgtaaaaaacgttccatggcaaatttgttg
aatcaaagcacagttcataacagcagtatttctgcaacggatccttgcatcagtgacttg
gaaaagtctcgattgaacgacaaaaaaagagaccgttacgactcacaggaccagctttgt
cagaacatgaaaaaactcaacattggatcagtaacgcaggatacccaactggattttctc
agttttgttacactgtacagatcttttagcatactgattcgtcacgatcttcaagatatt
ttcaaccagttggcggttgcttccatgagtcgagcaacactcaatggcgaaaagagtaga
agtgcgcccgaactgtctgaaatggcagtcaagcgactcttaacacggaattgctcgctg
gacttagagtcatctgacgcgaaacatacgcggaaaagacatttcgatactattgcagct
tctagtattgctgtgaaaaatgatcacataataagcagtaacaaagttatcactttggct
acgttgaaaaagtttctcgaaactcgccagatggaattacttaacgacgaggatgttaaa
acaattatacagcgacatgaaccggaagctgcacatcgtatcgaaaattgcatgagtttc
gaaggattcgcgcggtacatgatggacaaggataactacgcatttttaagtgaactgatg
ccggaaagcacttatatgaacttgccgctgtcccagtactacattgcttcttcgcacaat
acatatctaacaggacatcagctcaaaggggaaagttctgtcgaactgtacagtcaagtg
ttgttaactggtgcacgttgtgttgaactggactgttgggatggtgaggatggaacgccc
gtcatctaccatgggcacacattcaccacaaagattccgttccgagcggtggtggatgca
atcaacaaggccgcatttgttcagtctgcatatcccgtcatattgtcaattgaaaaccac
tgctcagttgtacaacagcaacgaatggcaacaatctttcagtccatttttggcgaaaaa
ttggtaacgaatttcctgttcgattatgactacacggacgaaccatttttgccttctccg
ctttcgctgaagcacaaaattctaatcaaaaataaaaagctgattgttgaagtaccagcg
accctatcgaccggattgactcgccagaatacgtacaaacagtcgaacttatcgagtcgg
gcaagttcaatcatatcgaacacgagtggcaattccttgaacgaagagtttagtgatgac
gaatatgaggacgatgatgatttcgacaatattgatgacaaaacatatcacgtaaattgg
ggatcaatagaggataagtctagacatagtttgtctcatggcaatatctcgactccaacg
aggcaacatttacagctccaacatcagcagcagttcttccagcaacaacaacaacagcaa
caacaacatcagcaacatctccaacaagaagaacgatctcgcaaacgcagcaaccaaatt
gctcgggagctatcggatttagtcatctacatccaagcaataaagtaccgcggtcttaat
ccttacagtccgcataattcaacacgtgccaatccgcgacagcaactcaaaactagtggt
agtgtagtgacagtaggaagtattctgaagaatagttccggtgacacgctgagcctcccc
tcgtcaagccatctttcggatagtctatcgttgagctatgactcgagcatgagtggtagc
gagagtcacttgccaccaacgactcgaacacgaaacatgccgaacgcaaaccatccgtgc
tatcagtgctcgtcgttgaacgaggctagtgcgaaaaaactttgccggaaggatccactg
ggactgattgctcacaccgaaactcaactgatgcgaacatatccagcggggctgagaatc
gactcgtccaactttaatccagtttggttttggtcgtttggatttcagatggtagcgttg
aactaccaaactgaagacatgccaatgcatatcaacaaagccatgttcgaagagaacaat
agctgtgggtatgtgcgcaaaccggatgtgctttggaaccgctcacatctcatgtatagg
cgttttaatccgctcgagaaagaatttgacggtttacacgtaacacagctggtgataaat
attgtctcgggtcagtatttgcaccacgtagcgaatggttccactattcatgtagaaata
gaactgctgggcattccaatcgattgcggccgaagacgaacgaaaccaatcaaacataat
ctcttcaacccggtgtggaacgaaacctttttcttcaagataatgtttcacgacttggcg
ttccttaagtttaccgtttacgagtccgagtcgataatcgtagcgcagcgagtgatatcg
ttgaaatgttttagacccggttatcgccatgtgcgcttacgatctccgacgaatcagccg
ctgcacatggcgtcacttttcgtttacacaagagtagaggaggaagggttagatagatcg
tatggtgaaattgatgagcaataccttcaacaaaccagacaagccaataggaaagatata
ccggaggatattgaaccgatattggaaagtaaagttcctttgctgaaacggaaaacattt
ttctgtaccgtgtatgatgcggtgccgaataatccattcacaatcctaaaaataacccaa
gaatgcacaacgaaggacgtactagtgatggtactgcaaaaaatgcacaaacaaaaggcg
gacatctcaaactttatcctgatagaggaagtgtacacgggatgggagaagaaggacaag
cgacatccgccgacgcaaagggttttggacatgactgaaaaaccgctgcaagcacaggcc
tgctggaaaggtgacgggcgttttatactgaaacggataggcaacgacccgagcagtcga
gcatgggtaacgtcaattcgtagaacagcggacgcaagaagggcttcgatcgcaactaca
accggcggtggggaagcggctggtggactacaagcaggatcaaccccggatgatccactc
gcactggagaacgtggacaactttctcgtctgtgtgttcaatgtttcgaacgacatacca
tacgcaatacttcgagtacctatcaaatcaactgcacaggatgtgctggcacaagctcta
ctgaaagcacggcgccttgataaccccaacaattttgtactggtcgaagaactaaactat
agcaacaaaagcaatgatactatgcagcgaatcctgctggacgatgaaaatgtgtacatg
acgcaggccaactggaagtcaatcggtcgctttgtcattcatgaacgaagccagctaaca
ccatcgacaatacgtaaaactatcctaccgattgagaaaataagccgtggcttcagcatc
agccggggctcctcgtcctcatcgacctctgttcactcgctgatctcaaagtcacctatc
caggttgcgttgagcgatccaaccacgtcaagaatcaagtgccgctcggcggatgtgcac
ggggcacgatcgaaacattcgcattcggggcccgggtccggcactagcatcggtggacgg
cacaagtatagttcggaaaaagaaacttctttttcaagtacaagtagcagtagtaacgcc
acatcgaaatcgagcaatcgtcgcgaggtacactcagagggcgaaacccttagtgacgag
gatgttaaagaaaacgacatcctttccacaatgtcgcgcttcaaacgaatgtctatcaaa
aaactcaaatcgtggaaatcctaa

DBGET integrated database retrieval system