KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ019024Help
Entry
CpipJ_CPIJ019024  CDS       T01079                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CpipJ_CPIJ019024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCSQCHTVEAGGKHKVGPNLHGLMGRKTGQAAGFSYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPGERADLIAYLKSATA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttcctgccggagatgttgagaagggcaagaagctgtttgtccagcgttgctcg
cagtgccacaccgtcgaggccggtggcaagcacaaggtcggcccgaacctgcacggtctg
atgggccgcaagactggccaggctgccggattctcctacaccgacgccaacaaggccaag
ggtatcacgtggaacgaggacaccctgttcgagtacctggaaaaccccaagaagtacatc
cccggaaccaagatgatcttcgccggtctgaagaagcccggagagcgcgccgatctgatc
gcgtacctcaagtcggccaccgcctaa

DBGET integrated database retrieval system