KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ019323Help
Entry
CpipJ_CPIJ019323  CDS       T01079                                 

Definition
histone-lysine n-methyltransferase
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cqu00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 669 aa AA seqDB search
MSSGEQQTQATTGQPHLQKQDLSQLDVTKLTPLSPEVISRQATINIGTIGHVAHGKSTVV
KAISGVQTVRFKNELERNITIKLEPLSDELIGRLTTSPAELAAYIKMTHERYKINGKRRR
NSADSPPDGHRLKQAKISSYFNGGGTTPAAADGGKYKQRNIEYYFNRNGMHKDHETNGLH
ERASRSMTPKLSRRTSVASDAGSVESGSSSTSRLRVRRKSLTYSDDSPSRTTTTTTTGTP
VAGSGKKRRSAAPPKANKDGEYSVESIVDIQEISNAPVFEIKWRGYSSKSNTWEPLPNIR
TCHAINEFLQWQLESYVETINEIRQELGETEQYREQVTLHETKSFKQILAEYEKFDPLAF
DSDMVLYAKIRANYAKNKRLHDRILANVGLEMSYRKRRDQLVKMKQFEDMINEFEPSSKI
AVENDEDSDVPQENFKYIKENLAGEGVTIPDDPPYGCECDQCNFRSDCCGKMAGSKMAYN
TKKRLNAPPGMPIYECNKRCRCSADCTNRVMQNGRKFNVSLFKTSNGRGWGVKTNQTIYE
GWYITEYIGEVITYEEAEKRGREYDAVGRTYLFDLDFNGSDNPYTIDAANYGNIARFINH
SCDPNCGIWSVWVNCLDPNLPRLAFFAKRKIEAGEELTINYQTQINESRAMDNLTECRCG
ADNCKKYVF
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccggcgagcagcaaacacaggccactaccggccagccgcacctccaaaaacaa
gacctttcccagctggacgtcaccaagctgacgccgctgtcgcccgaggtcatctcgcgc
caggccacgatcaacatcggcacgatcgggcacgtggcccacggcaagtccaccgtggtc
aaggccatctccggtgtgcagacggtgcgcttcaagaacgaactggagcgtaacatcacc
atcaagctggagccgttgtcggatgagctcatcggtcggctaacgacgtccccggccgag
ctggccgcgtatattaaaatgacccacgagcggtacaaaatcaacggcaagcggcgccgc
aattccgcggattcgcctccggacgggcaccgcctgaagcaggcgaagatttccagctac
tttaacgggggcggaacgacgccggccgccgcggacggtggcaaatacaagcaaagaaat
atcgagtattattttaaccggaacggaatgcacaaagaccatgagaccaatggactgcac
gaacgtgcgagtcgcagcatgacgccgaagctgtcccggcggacgtcggttgcgagtgac
gcagggagtgttgagtcggggtcgtcgtcgacatcgcgactgcgagtgcggcgtaagtcg
ttgacctattcggatgactcgccgtcgcggacgacgacaacgacgacgacgggaacgccg
gtagctgggagtggcaagaagcgacgatcggcggcaccgcccaaggccaacaaagacggc
gagtactcggtggagagtattgtggatattcaggagatttcgaacgcaccagttttcgag
atcaagtggcgtggatacagctcgaagagcaacacttgggaaccgttgccgaacatccgc
acgtgccacgcgatcaacgagtttttgcagtggcagctcgagtcgtacgtggagacgatc
aacgaaatacggcaggagttgggcgagacggagcagtatcgggagcaggttacgttgcat
gagaccaaatcgttcaagcaaattctggccgaatatgaaaagtttgatccacttgcgttc
gatagcgatatggtgttgtacgccaagattcgtgcgaattacgccaagaacaagcggctg
cacgatcggatcctggcgaatgttggcctggagatgtcctaccggaagcgacgcgatcag
ctcgtcaagatgaagcagttcgaggacatgatcaacgaatttgagccgagcagcaagatt
gcggtggagaacgatgaagattcggacgtgccacaggagaacttcaagtacatcaaggag
aacctagccggggagggcgtcaccatcccggacgatccgccgtacgggtgcgagtgcgac
cagtgcaacttccggagcgattgctgcggcaaaatggccggttccaagatggcatacaac
acgaaaaagcgactgaacgcacctcccggcatgccgatctacgagtgtaacaagcggtgc
cgttgcagcgcggattgtacgaaccgggtcatgcagaacgggcgcaagttcaacgtgtcg
ctgttcaaaaccagcaacggacgcggctggggcgtcaaaaccaaccaaaccatctacgag
ggctggtacatcacggagtacatcggcgaggtcatcacgtacgaggaggcagagaagcga
ggtcgcgagtacgacgccgtcggccgcacctacctctttgatctggactttaacgggagt
gacaatccgtacacgatcgatgcggccaactacggcaacattgcccgcttcatcaaccac
tcgtgcgaccccaactgtggcatctggtcggtttgggtcaactgcctggatccgaatctg
ccccggttggcgttcttcgccaagcggaaaatcgaagccggcgaagagctcacgatcaac
taccaaacgcagatcaacgagagccgggcgatggacaacttgaccgagtgccgctgcgga
gcggataattgcaagaaatacgttttttag

DBGET integrated database retrieval system