KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ019469Help
Entry
CpipJ_CPIJ019469  CDS       T01079                                 

Definition
disulfide-isomerase A5
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Brite
Enzymes [BR:cqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CpipJ_CPIJ019469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 600 aa AA seqDB search
MKELKKLFRTKNNVLVLFVSSQKEAHSTLNAFRDAAEIIKGQGTMVLLDCSNGEMKKMCK
KLKAQPSPYTLKHYKDGDFHKDYDRQLTATSMANFMRDPTGDLPWEEDPVGVDVVHVPDA
VALGKFLKKEVRPILVMFYAPWCGFCKTLKPEFSGAATELKPKYVLAAIDVNRPENSIIR
KQYNITGFPTLLYYENGRMKHTFDGENNKAGIVAFMKNPAAPPPTKPKEPDWASEPSSEI
VHLGSANFEPALKDEKSALVMFYAPWCGHCKKMKPEYEKAATIMKESKIAGVLAALDATK
EQAIAQQFGVRGYPTVKYFSNGQFKFDANVRDADKIVEFMKNPSEPPPPPAPEAPWEEEQ
NEVVHLNDETFKPFLKKKKHVLVMFYAPWCGHCKRAKPEFGKAAEHFKEDPKVALAAVDC
TRHNGVCSAYEVRGYPTLKYFSYLKTVKEYNGGRLEADFIKFLSDPTAPTAEKAAAEPYG
DFPGSDKLIIMTDKTADDVLQNEDRVLVMFYAPWCGHCKRMKPDFAEVANLLVQHNVPGK
VAAVDCTEHPKTAERFEIQGFPTLKYFVRGKFVKNYEGKRTAQAMFEFIRSNGASTKDEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagctgaaaaagctgttccggacgaaaaataacgtgctcgtgctgttcgtgtcc
agccagaaggaggcgcacagcactctgaacgcgttccgcgatgccgccgaaatcataaag
ggccagggcacgatggttctgctggactgcagcaacggtgaaatgaagaagatgtgcaaa
aagttgaaggcgcaaccgagcccgtacacgctgaagcactacaaggatggggacttccac
aaggactacgaccggcagctgacggccaccagtatggcgaactttatgcgcgatccgacg
ggagacttgccgtgggaggaagatccggtcggggtggacgtcgtgcacgtgccggacgcg
gtggctctggggaagtttctgaagaaggaggtgcggccgattctggtcatgttctacgca
ccgtggtgcggcttctgcaagacgttgaagccggagttttccggcgccgcgacggaactc
aagccgaagtatgtgctggcggcgatcgacgtgaaccggccggagaactcgatcatccgc
aagcagtacaacattaccggatttcccacgttgctgtactacgagaacggccgcatgaag
cacaccttcgacggggagaacaacaaggccggaatcgtggcgttcatgaagaacccggcc
gctccaccgccaaccaagccgaaagagccggactgggcgtcggaaccgagctcggagatc
gtgcacctgggcagtgccaactttgaacccgctctgaaggacgaaaagtccgcgctggtc
atgttctacgcgccgtggtgtggccactgcaaaaagatgaagccggagtacgagaaggcc
gccaccatcatgaaggagagtaaaatcgccggcgtgctggccgcgctggatgccaccaag
gagcaggccattgcgcagcagtttggcgtgcgaggttatccgacggtgaagtactttagc
aacgggcagttcaagttcgatgcgaacgttcgcgacgcggacaagattgtggagtttatg
aagaatccatcggagccgccaccgccaccagctccggaagcgccgtgggaggaggagcag
aacgaggtggtccatctgaacgatgaaacgttcaagccattcctgaagaagaagaagcac
gtgctcgtcatgttctatgcgccttggtgcggtcactgcaagcgagccaagcccgagttt
ggcaaagctgcggaacacttcaaggaagaccccaaggttgccctcgccgctgtggactgc
acgcgccacaacggagtctgctcggcgtacgaagtgcgcggttatccgacgctcaaatac
ttcagctatctgaaaaccgtcaaggagtacaacggaggtcgcctggaagcggactttatc
aagttcctcagcgatccaaccgccccaacggcggagaaggccgccgccgaaccgtacgga
gacttccccggctcggacaagctcatcatcatgacggacaaaaccgccgacgacgtgctg
caaaacgaggatcgcgtcctcgtgatgttctacgctccgtggtgcggccactgcaagcgc
atgaagccggactttgccgaggtggcgaacctcctcgtccagcacaacgtcccaggtaag
gtggcggccgtcgattgcaccgagcacccgaaaacggcagaacggttcgaaatccagggc
ttccccacgctcaaatactttgtccgggggaagtttgtcaagaactacgagggcaagcga
acggcccaggccatgtttgagtttatccgttcgaacggggccagcacaaaggatgagctg
tga

DBGET integrated database retrieval system