KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ020026Help
Entry
CpipJ_CPIJ020026  CDS       T01079                                 

Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CpipJ_CPIJ020026
Enzymes [BR:cqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CpipJ_CPIJ020026
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CpipJ_CPIJ020026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 672 aa AA seqDB search
MLKPGSVVAIRVALKDSVKPHIDNLQELVREFHCDKGSRYAELQHLLGKLDLVDFNNLLY
CCAEEERDNGGGPYNLPGYGDLVYCGLQGIVSILSDIGPSNDLGHPLANNLRTGDWLIDH
CSLRLKNYPNLAPVASWLEKNLAALKQIPRYMIPSYFDVILTGVHRLAIAAACNRMTDFV
RQGSTFGKRLALGSVQCVRVAPSANLPKLSPNVNDPKPPERCSTLAAGLPHFATGYMRCW
GRDTFIALRGLMFLTGRFDEARYMILGFGGCLRHGLIPNLLDGGLNARFNCRDAIWWWMY
CVKLYVEEAPNGKAILKDKVSRLYPTDDSEPKAPGECDQLLYETIQEALAVHFQGLSYRE
RNAGTRIDAHMKDKGFNNRIGINPETGFVFGGNNANCGTWMDKMGSCDKSGNRGVPSSPR
DGSAVELVGLQMASLRFMQRMAEEKVIPCTGVERTTNGTKTTWTYKQWADKISDNFEKHF
YVDESTDSKFVNKKGMYKDTLGSEIPWTDFQLRCNFPIALCVAPELCDPKHAWRALETAK
KYLLGPLGMKTLDFEDWGYRGNYDNSIDSDDKSVSHGANYHNGPEWVWPIGFYLRARLFF
AKANGLLKETVAETWSILQTHLNELQRCHWRGLAELTNENGAYCNDSCRTQAWSMGCVLE
VLYDLEKYEKEL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaccgggctcggtggtggccatccgggtggcgctcaaggacagcgtgaagcct
cacattgacaatctgcaggagctggtgcgggagttccattgtgacaagggatcgcggtat
gctgagttgcagcatttgttggggaagttggatttggttgatttcaacaatttgctgtat
tgttgtgcggaggaagagcgggacaatggcgggggtccgtacaatctgcctgggtacggg
gatttggtttattgtgggttgcaggggattgtttcgattttgagcgatattgggccgagc
aatgatttgggccatccgttggcgaacaatttgcggacgggggattggctgatcgatcac
tgttcgttgcggttgaagaactatccgaatttggcgccggtggcgagttggttggagaag
aatttggctgcgctgaagcagattccgcggtacatgattccgagctactttgacgtgatt
ttgacgggggttcatcggttggcgattgcggcggcttgcaacaggatgacggatttcgtg
cggcaagggtcgacgtttgggaagaggttggcgttggggtcggttcagtgtgtgagggtt
gcgccgtcggcgaatttgccaaagctcagtcctaatgtgaacgatccgaagccgccggag
cgctgctcgacgttggccgctggattgccgcactttgcgaccggttacatgcgctgctgg
ggtcgggacacgttcattgcgctgcgtggactgatgttcctgacgggtcggttcgacgag
gctcggtatatgattctcggatttggtggatgtcttcgtcacgggttgattccgaacttg
ctggatggtgggttgaacgcacggttcaactgtcgggacgcgatttggtggtggatgtac
tgcgtgaagttgtacgtcgaggaagcgcccaatggtaaggcgatcctgaaggacaaggta
tctcggttgtacccgacggacgacagcgagccgaaggctcctggtgagtgtgaccaactg
ttgtacgaaacgatccaagaagcgctggctgtacacttccaggggctgtcgtaccgcgag
cgtaacgccggaactcgcatcgatgcgcacatgaaggacaagggcttcaacaaccggatt
ggaatcaacccggagacgggcttcgtgtttggtggcaacaacgccaactgcggcacctgg
atggacaagatgggctcgtgcgacaagtccggcaaccggggcgtcccctcgtcaccgcgc
gatggctcggccgtcgagttggtcggtctgcagatggccagtttgcggttcatgcagcga
atggccgaggaaaaggtcatcccttgcaccggcgttgaacgcaccaccaacggaaccaaa
accacctggacgtacaaacagtgggcggacaaaatctccgacaacttcgagaagcacttt
tacgtggacgaatccaccgacagcaagttcgtcaacaagaagggcatgtacaaggacacg
ctcggctcggaaatcccctggaccgacttccaactccgctgcaacttcccgatcgccctc
tgtgtcgcccccgaactgtgcgaccccaagcacgcctggagagcgctcgaaaccgccaaa
aagtacctgctcggaccgctcggcatgaagacgctcgacttcgaggactggggctaccgc
ggaaactacgacaactccatcgacagcgacgacaagtccgtctcgcacggcgccaactac
cacaacgggcccgagtgggtgtggccaatcgggttctacctccgcgcccgactcttcttc
gccaaggccaatggactgctcaaggaaacggtcgccgaaacgtggtccatcctgcagacg
cacctcaacgagctgcagcgctgtcactggcgcggcctcgccgaactcaccaacgaaaat
ggcgcctactgcaacgactcgtgccggacgcaggcctggagcatgggctgcgtgctcgaa
gtcctctacgatctggaaaagtacgaaaaggaactctaa

DBGET integrated database retrieval system