KEGG   Culex quinquefasciatus (southern house mosquito): CpipJ_CPIJ020263Help
Entry
CpipJ_CPIJ020263  CDS       T01079                                 

Definition
fatty acid oxidation complex subunit alpha
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
cqu  Culex quinquefasciatus (southern house mosquito)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cqu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CpipJ_CPIJ020263
   01212 Fatty acid metabolism
    CpipJ_CPIJ020263
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CpipJ_CPIJ020263
   00650 Butanoate metabolism
    CpipJ_CPIJ020263
  Lipid metabolism
   00062 Fatty acid elongation
    CpipJ_CPIJ020263
   00071 Fatty acid degradation
    CpipJ_CPIJ020263
   01040 Biosynthesis of unsaturated fatty acids
    CpipJ_CPIJ020263
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CpipJ_CPIJ020263
   00310 Lysine degradation
    CpipJ_CPIJ020263
   00380 Tryptophan metabolism
    CpipJ_CPIJ020263
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CpipJ_CPIJ020263
Enzymes [BR:cqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     CpipJ_CPIJ020263
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CpipJ_CPIJ020263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
VectorBase: 
UniProt: 
AA seq 744 aa AA seqDB search
MTVETSRFLASAPAAKHIKTKVVDGVLVVTLDSPGVKVNSLGAEVQAEFDAVFRELETNP
ALSSAVVISAKPGCFIAGADITMLEKCKTVEEATKISHEGQLQFNKMEKSRKPIVAAING
VCLGGGLELALACQYRIAVKSKKTNLGLPEVMLGLLPGAGGTQRLPKLSSIPTALDLALT
GKNVKADKAKKLGIVDLLVNPLGPGLKNSEDSTIEYLEKVAIQAAKDIASDKLKVNRKKG
GLVNGVMDFAFSIDWVKDKVFGKAREQVMKMSGGLYPAPLKILDVIRTGVDKGFEVGSEA
ERKGFGELSQTPQSKGLIGLFRGQTECKKNRFGKPANPPKTIGVLGAGLMGAGIVQVSID
KGYHVVMKDTTEAGLGRGIGQVQTGLQNAIKRKRISAIERDQILSNLNPTLNYDEFRNVD
IVIEAVFENLDIKHKVIKELEQVIPKHAIIATNTSAIPITKIAAGSSRPDKVVGMHYFSP
VDKMQLLEIITHPGTSKETAAAAVEVGLKQGKVVITVGDGPGFYTTRILSTMLSEAIRLL
QEGVDPKDLDKMTKSFGFPVGAATLADEVGIDVGAHIAVDLAKAFGDRFSGGNLGVMEDM
VKAGFMGRKSGKGVFVYEGGRSKNREVNHEALAILNQKYALQSRGANSVEDMQLRMVSRF
VNEAVLCLEEKILDSPLEGDVGAVFGLGFPPFTGGPFRWVDQYGAGKLVDKMRSYADLYG
APFQPAQTLVDMAKDSTKKFYASK
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgaaacgagccgcttcctggccagtgcgcccgccgccaagcacatcaagacc
aaggtcgtcgacggcgtgctggtggtgacgctggactcgcccggcgtcaaggtcaactcg
ctcggtgccgaggtgcaggccgagttcgatgccgtgttccgcgagctggagacgaacccc
gccctcagctctgcggtggtcatttcggccaaaccgggctgtttcatcgcgggggccgac
attaccatgctggaaaagtgcaagacggtcgaggaagcgacgaagatctcgcacgagggc
caacttcagttcaacaagatggagaagagccgcaagccgattgtggccgcgatcaacgga
gtttgtctgggaggagggctggagctggcgctggcctgtcagtaccggattgcggttaag
agcaagaagacgaatttggggttgccggaggtgatgttgggtctgctgcccggggcgggc
ggaactcagcgactgccgaagttgtcgtcgattccgacggcgctggatttggcgctgacc
gggaagaacgtcaaggccgacaaggccaagaagctgggcattgtggacttgctggtgaat
ccgttgggtccgggactgaagaactccgaagacagcacgatcgagtacctggagaaggtt
gccatccaggcggccaaggacattgcctcggataagctgaaggtgaaccgcaagaagggt
gggctcgtgaacggcgtcatggatttcgccttctcgattgactgggtcaaggacaaggtg
tttggcaaggcgcgcgagcaggtcatgaagatgtccggtggattgtatccggcgccgttg
aagattttggacgtgattcgcaccggcgtcgacaagggcttcgaggttggttcggaggcg
gaacgcaagggattcggagagttgtcgcagactccacaatcgaagggtctcatcgggctg
ttccgtggtcagactgagtgcaagaagaaccgttttggcaagcccgccaacccgccaaag
actattggcgtgctgggcgcgggtctgatgggagccggtatcgtgcaagtgagtatcgat
aagggttatcacgtcgtgatgaaggacaccacggaggcgggtctgggccgcggtattgga
caggtccaaaccggtctgcagaacgccatcaagcgaaaacggatcagcgcgatcgagcgc
gatcagatcctgtccaacctgaaccctacgctgaactacgacgagttccgcaatgtggac
attgtcattgaggcggtgtttgagaacttggacatcaagcacaaggtgatcaaggagctg
gagcaggtcatcccgaagcatgccatcattgcgacaaacacgtcggcgattccgatcacc
aagattgccgcgggaagctcgcgtccggacaaggttgtcggaatgcactacttctccccg
gtagacaagatgcaattgctggagatcatcacccacccgggaacgtcgaaggaaacggcc
gccgctgccgtcgaggttggcttgaagcagggcaaggttgtgatcaccgtcggcgatgga
ccaggcttctacacgacccgtattttgtccacgatgttgtccgaagcgatccgcctcctg
caggagggcgttgacccgaaggatctggacaagatgaccaaatcgtttggtttcccggtg
ggagccgccaccctggccgatgaggtcggaatcgacgtcggtgctcacatcgcggttgac
ctggccaaggcctttggcgatcgcttcagcggtggcaaccttggcgtcatggaagacatg
gtcaaggccggtttcatgggacgcaagtccggcaagggagtgtttgtgtacgaaggtggc
cgcagcaagaaccgcgaggtcaaccacgaagccctcgccatcctgaaccagaagtacgcg
ttgcaatcgcgtggtgccaacagcgtcgaggacatgcagctgcgaatggtgtcccggttc
gtgaacgaggccgtgctctgtctggaggagaagatcctggacagcccgctggagggtgac
gttggtgccgtgttcggacttggattcccaccgttcaccggtggaccgttccgctgggtg
gaccagtacggcgcgggcaagctagtcgacaagatgcggtcgtacgccgatctgtacgga
gctccattccagccggcgcaaaccctggtcgacatggcgaaggactcgacgaagaagttt
tatgctagcaagtaa

DBGET integrated database retrieval system