KEGG   Chlamydia trachomatis A2497: CTO_0032Help
Entry
CTO_0032          CDS       T02094                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cra  Chlamydia trachomatis A2497
Pathway
cra00230  Purine metabolism
cra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CTO_0032
Enzymes [BR:cra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CTO_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Thymidylate_kin dNK Stealth_CR3 AAA_22 AAA_16 AAA_17 Zeta_toxin AAA_23 AAA_33 AAA_30 AAA RNA_helicase TsaE
Motif
Other DBs
NCBI-ProteinID: AEP34836
UniProt: G4NNY1
Position
34390..35007
Genome map
AA seq 205 aa AA seqDB search
MSVKVISPFSQDGVQCFPKLFIISAPAGAGKTTLTHMLQREFPDAFEKTVSSTTRSARPG
EVHGVDYLFVSEDDFKQSLDREDFLEWVFLFGTYYGTSKAEISRVLQKGKHCIAVIDVQG
ALALKKQMPAVTIFIQAPSQEELERRLNARDSEKDFQKKERLEHSAVEIAAASEFDYVVV
NDDLITAYQVLRSIFIAEEHRMSHG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaaggttatttcccccttttctcaagacggggttcaatgctttcccaagctt
tttatcattagcgctcctgctggagcagggaagacaacactcacccatatgctacaaaga
gagtttcctgatgcatttgagaagacggtgtcgtcaacgacacgttcggctcgtccaggc
gaagtgcatggcgtggattatttgtttgtatctgaagatgactttaagcaatctttagat
agggaagattttttggaatgggtctttttatttgggacttattacggaacgagtaaggcg
gagatttctagagttctgcaaaagggtaagcactgtatagccgtgattgatgtacaagga
gctttggctctgaagaagcaaatgccggcagtcactatttttattcaagctccctctcaa
gaagaacttgagcgccgtttgaatgctcgggattcagagaaagatttccagaagaaagaa
agattagagcatagcgctgtcgaaattgctgccgctagcgaatttgattatgttgtggtt
aatgatgatttgattacagcatatcaagttttaagaagtatttttatagctgaagaacat
aggatgagtcatggctag

DBGET integrated database retrieval system