KEGG   Chlamydia trachomatis A2497: CTO_0035Help
Entry
CTO_0035          CDS       T02094                                 

Definition
Exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cra  Chlamydia trachomatis A2497
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CTO_0035
Enzymes [BR:cra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CTO_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37094..39334)
Genome map
AA seq 746 aa AA seqDB search
MGCEEKLSGILELILPEDPLSDQTGYAFLRVPYKNSLVTVCGHLPLSLFKIGSSVDLTGH
WSVDASGALVFHFTSAATYSPDSGIIAYLNAQIKGVGPKLAQKIVSTFREDTLTVLDSCP
SKLVEVDGISPARCEDFSKQLQEQRDLRHALLFLQRHGIAIHYGLRLYKKYQNQTIEKVC
QDPFLLAKEMYGIGFKTADLIATCLGVPLNSPNRIVAGIQYSLDELQEEGHTCYPLNDFI
VLVEKLLNEEAPEEIIRKEEIRTQIHFLSRQKTVYVKELEQDTYIWSRQLFLAEQQIAID
IRRLLFSSKRIRSINTQEAILEVENLLDLKLEEKQKEALHASSSQKIHIISGGPGTGKST
ITRAILSIFEKISSPKKIILAAPTGKAAKRMTEITGKRTQTIHSLLQYDFKTLSFRKNHE
DPIDCDLVIVDESGMIDTILLQRFLAALPDHAILILIGDVHQLPSVGPGNVLKDLILSHH
IEVTYLTKIFRQLQNSNIITNAHKVNQGEFPVLNSSSGKKDFLFFQKEDPEEAIKHIIHL
VSDFVPKKFGIFTEDIQVLAPMRKGVLGILNLNRELKAALNPNKLFIQGKFHSFSTGDRV
MQTRNNYNKEVFNGDIGYVTSIDLSTKSLIVCVDGRYISYSQAELNDLIPAYATSIHKYQ
GSETSCIILPIHTSHYVMLYRNLLYTAITRGKKLVILVGTKKAVAIAVRNNKVQHRCTGL
QQAMHSLLNKPTPLFSPYTICRPSLG
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgggttgtgaagagaaactttccggtattttggagctgatcctgccagaagatcccctg
tccgatcaaacagggtacgccttcctacgagtcccttacaaaaattcactagtaactgtt
tgtggccatctcccgctctctttgtttaaaatcggctcctctgtagacttaacaggtcat
tggagtgtagatgctagcggagcattagtgtttcactttacttccgctgcaacctatagt
cctgattccggaatcatagcttacctgaatgctcaaatcaaaggcgtaggccccaaactt
gctcaaaaaattgtctcaaccttcagggaagacacgttaacagtactcgattcctgtcct
tctaaattggtagaagtagatgggatttctcctgcccgctgcgaagatttttctaagcaa
ctccaagagcaaagagacctacgtcatgctttgttatttctacaacgacatggaatagcc
attcattatggtttacggctgtataaaaaataccaaaatcaaacgatcgagaaggtctgt
caagatccctttctgcttgcaaaggaaatgtacggtataggttttaaaaccgctgatctt
attgctacgtgcttaggagtccctctaaattcccctaatcgtatcgttgctggaattcaa
tactctctagatgaacttcaagaagaagggcatacctgctaccctcttaatgattttatt
gttctcgtagaaaaactgttgaatgaagaagctccagaggagatcatacggaaagaggaa
atccgtacccaaatccatttcttgtcacgccagaagacagtctatgtcaaggaactcgaa
caagatacctatatttggtcgcgccaactttttctagctgaacaacaaattgcgattgat
attcgaagactcttgttttcttctaaacgaatacgatctatcaatacccaggaagcgatt
ctggaggttgaaaatcttctggatttgaaattagaagaaaaacaaaaagaagctcttcat
gctagctcttcacaaaagattcatattatatctgggggaccaggaacaggaaaaagtaca
attacacgtgctatcctttctatctttgaaaagatctcctcccctaagaaaataatccta
gcagcacctacaggaaaagctgcgaaacgtatgacagaaatcacagggaaacgtactcaa
actatccactctcttctccagtatgatttcaaaaccttgtcatttcgaaagaatcacgaa
gatcctattgattgtgatcttgttattgtcgatgaatccggaatgatcgacaccattctc
ttacagcgctttctagctgcactgcctgatcatgctatcctaattctaattggagatgtg
caccagcttcccagcgtaggccctggtaatgtccttaaagatcttattctttcccatcac
atcgaggtaacctacctaacgaaaatcttccgtcagttgcaaaattcgaatatcattaca
aatgcccataaagtaaaccaaggagaattcccggttctcaacagctcttcagggaaaaaa
gactttttattttttcaaaaagaagaccctgaagaagcgattaaacacatcattcatctc
gtttcggattttgttcctaaaaaatttggtatctttaccgaagatattcaagtccttgct
cctatgagaaaaggggtattaggaatactcaatctaaatagagagttaaaagcagcactt
aatcctaataaactgtttatccaagggaaatttcactccttctctacgggagatcgcgtt
atgcaaacgcgtaataactataataaagaggtattcaacggagatatcggttatgtgacc
tctattgacctatctacaaagagtttgatcgtttgcgtggatggccgctatattagttat
tcgcaagcagaactcaatgacctgataccagcttatgctacttccatacacaaataccaa
ggaagtgagacctcctgtattattcttcctattcacacctctcattacgtgatgctgtat
agaaacttactctatacagcaattacacgagggaaaaaactagtcattttagtaggaaca
aagaaagcagttgctattgctgttcgtaataataaggttcaacaccgatgtaccgggctg
caacaagctatgcactcccttcttaacaaaccaactcctcttttctctccttacactatt
tgtagaccgtctctaggataa

DBGET integrated database retrieval system