KEGG   Chlamydia trachomatis A2497: CTO_0186Help
Entry
CTO_0186          CDS       T02094                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cra  Chlamydia trachomatis A2497
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CTO_0186
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTO_0186
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTO_0186
Enzymes [BR:cra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTO_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
196446..196979
Genome map
AA seq 177 aa AA seqDB search
MLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGVCVIDLPAPLSHGEKS
PFEDLLAVGLDPILLISAGTTPERMSLIQEHARGLLYYIPYQATRDSEVGIKEEFRKVRE
HFDLPIVDRRDICDKKEAAHVLNYSDGFIVKTAFVHQTTMDSSVETLTALAQTVIPG
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
ttgttagagatcgtagaaggtatccgagcttttaatcaagaagtcccattgatcttatat
agctactacaatccgcttctacaaagggacttagattatctacgcagactaaaagacgcg
ggaataaatggtgtgtgcgttatagatcttccagcacctttatcacacggagaaaaatct
ccttttgaagatcttttagctgtaggattggatcctattttgcttatttctgcagggaca
actccggagcggatgtctttaatacaagaacacgcaagaggccttctgtattatatccca
taccaagctacgagagattctgaagtaggtatcaaagaagaatttcgaaaagtcagagaa
cattttgatcttccaattgtagatagaagagatatttgtgataaaaaagaagctgcacat
gtgctgaattattcagatggtttcattgtgaaaacagcgtttgttcatcagacaacaatg
gattcttcggtagagactctgactgcacttgcacaaacagttattcctggataa

DBGET integrated database retrieval system