KEGG   Chlamydia trachomatis A2497: CTO_0223Help
Entry
CTO_0223          CDS       T02094                                 

Definition
Pyrophosphate--fructose 6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cra  Chlamydia trachomatis A2497
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTO_0223
   01230 Biosynthesis of amino acids
    CTO_0223
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTO_0223
   00030 Pentose phosphate pathway
    CTO_0223
   00051 Fructose and mannose metabolism
    CTO_0223
   00052 Galactose metabolism
    CTO_0223
  Energy metabolism
   00680 Methane metabolism
    CTO_0223
Enzymes [BR:cra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTO_0223
Protein phosphatases and associated proteins [BR:cra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTO_0223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
232197..233876
Genome map
AA seq 559 aa AA seqDB search
MFEQKLMSSNKHASLCQKTPSLCRELQKAPALLLTEDIRFKALLNERIDSVAELFPCTYN
SPYYKFISKSDLSAETSPLKVGVMLSGGPAPGGHNVILGLLHSIKKLHPDSQLLGFIRNG
EGLLNNNTVEITDEFIEEFRNSGGFNCIGTGRTNIITEENKARCLQTANELDLDGLVIIG
GDGSNTATAILAEYFAKHQAKTVLVGVPKTIDGDLQHLFLDLTFGFDTATKFYSSIISNI
SRDTLSCKGHYHFIKLMGRSSSHITLECALQTHPNIALIGEEIAEKSISLETLIHDICET
IADRAAMGKYHGVILIPEGVIEFIPEIQSLVKEIESIPEQENLYQALSLSSQQLLCQFPE
DICHQLLYNRDAHGNVYVSKISVDKLLIHLVRQHLETHFRQVPFNAISHFLGYEGRSGTP
THFDNVYSYNLGYGAGVLVFNRCNGYLSTIEGLTSPIEKWRLRALPIVRMLTTKQGKDSK
HYPLIKKRLVDIASPVFNKFSLYRKIWALEDSYRFVGPLQIHSPEDAHSDDFPPLILFLN
HNEWQKRCSICLEIPDQDY
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgagcaaaagcttatgtcgtcgaataaacatgcttctctttgtcaaaagacgcct
tctttgtgtcgggagcttcaaaaagctcctgctcttctattaacagaagacataaggttt
aaagctcttcttaatgaacgcattgactctgttgcagaactatttccatgcacttataac
tctccctactacaaatttatttcgaagtccgatctttccgctgagacctctccccttaaa
gtgggcgttatgctttctggaggcccagctcctggtgggcacaatgtcatcttaggattg
ctacacagtattaaaaagctccatccggatagtcagcttttaggatttattcgcaatgga
gaaggacttctcaataataatactgtagaaatcacagatgaattcattgaagagtttcgt
aactctggaggctttaattgcataggaacaggtcgcactaatatcataaccgaagaaaac
aaagcgcgctgtttacaaacagcaaatgaactcgatttagatggattagtgattattgga
ggcgatggttcgaatacagccacggcgattcttgctgaatattttgctaagcatcaagca
aaaacggtattagttggtgttcctaaaactattgatggagatttgcagcacctattttta
gacctcacatttgggtttgatactgctactaaattttattcatccatcatcagcaacatt
tctagagacacattatcgtgtaaaggccattatcattttattaaactaatgggtcggtct
tcttctcatatcacgctagaatgcgcactacagactcacccaaatattgctcttataggc
gaagagattgcagaaaaaagcatctccttagaaacattaatccatgatatttgtgaaaca
atagcagatcgagctgctatggggaaataccatggcgttattctcatccctgaaggagtc
attgagtttattcctgaaatacagtctctggttaaagaaattgaatccattccagagcag
gagaatctttaccaagctttatccttatcttctcagcaacttttatgccaatttccggaa
gatatttgccatcagctcttgtataatagagatgctcatggcaacgtctatgtatcaaaa
attagtgttgataaacttctgattcatctagttcgtcaacatttagaaacacattttaga
caagttcccttcaatgcaatctcccattttttaggttatgaagggcgttcaggaactcct
acacattttgataatgtgtatagctataacttaggatatggtgctggggttctcgttttt
aaccgctgtaatgggtatttatccacgatcgaaggtctaactagccctattgaaaaatgg
cgattgcgcgctttacccattgttcgaatgttgacgaccaagcaggggaaagacagtaaa
cattatcctctgataaaaaaaagattggtagatattgctagtcctgtttttaataagttc
tcactgtatcggaaaatctgggctttagaagactcctatcgctttgtagggccattacaa
atacattctccggaggatgctcattctgatgattttcctcctttaattttgtttttgaat
cataatgaatggcaaaaacgctgttctatttgtttagaaatccccgatcaggattattaa

DBGET integrated database retrieval system