KEGG   Chlamydia trachomatis A2497: CTO_0269Help
Entry
CTO_0269          CDS       T02094                                 

Definition
Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cra  Chlamydia trachomatis A2497
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTO_0269
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTO_0269
   00020 Citrate cycle (TCA cycle)
    CTO_0269
   00620 Pyruvate metabolism
    CTO_0269
Enzymes [BR:cra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CTO_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
277699..278988
Genome map
AA seq 429 aa AA seqDB search
MVSLLKMPKLSPTMEIGILVKWHKKAGDEIHFGDVLLEISTDKAVLEHTASEDGWLLEIL
VEEGTKTPIGTPIAVFSTEQNAQYDLKQLLPLEGTVVTDAATEASPKNSAQTDSQYTSGP
SITMMGFRPEPPLAIPLTIKHSNDPVLASPLAKKLAKEQNLDLSGVTGSGPGGRIVKKDL
EKAPPLRIAGFGYPEAPNVNPGSYIEEPLSPVREVISKRLQAAKTFIPHFYVRQRIYASP
LLALLKELQEQNIKLSINDCIVRACALALKEFPEINSGFNSVDNKIIRFSTIDISIAVAI
PDGVITPIVRCADRKNIGMISAEIKGLATKAKQQSLAEEEYKGGSFCVSNLGMTGISDFT
AILNPPQAAILAVGSVEEQPVVLNGELAVGLTCMLTLSVDHRVIDGYPAAMFMKRLQRLL
EAPSVLLLN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggtttctttgttaaaaatgcctaagctctcccctacaatggaaatagggattcttgtt
aaatggcacaaaaaagctggggatgaaattcatttcggggatgtattactagaaatctct
actgataaagctgttttagaacatacagcttctgaagatggttggttattagaaattctt
gttgaagaaggaaccaaaactcctattggcactcctatcgctgtattttcaacagaacaa
aatgctcaatatgatttaaaacagctcctacctttggaaggaactgttgttacagatgca
gctacagaagcatcgccaaaaaactctgctcaaacagattctcaatacacaagtggccct
tccataactatgatgggattccgtccggaaccacctttagctattcctctaactattaaa
cattccaacgatccagtattagcttctcctttagcaaaaaaattggccaaagagcaaaat
ctagacctctctggagtaactggtagtggacctggaggacggatcgtaaagaaagatttg
gaaaaagctcctcctttaagaattgctgggtttggttaccctgaagctccaaatgttaat
ccgggatcttatatagaagaacctctttcccctgttcgagaagtcatatctaaacgtctg
caagctgctaaaacctttattcctcacttttatgtaaggcagcgcatttacgcttccccc
cttcttgcattattaaaagaacttcaagaacaaaatattaagctctctatcaatgattgt
attgtacgagcctgtgctttagctctgaaagaattcccagaaattaattctggattcaat
agtgtcgacaataagattattcggttttctacgattgatatctctattgctgtagctatt
cctgatggagttatcactcctattgtccgctgtgctgatagaaaaaatattggtatgatc
tctgcagaaatcaaaggacttgcaactaaagccaaacagcagtctcttgcagaagaagaa
tataaaggaggttctttctgtgtatctaatcttggtatgacagggatctctgatttcact
gctattttgaatcctccacaagctgctattctagctgtaggaagcgtagaggaacaacct
gtagtcttaaatggagagctagctgtaggcttgacctgtatgttgacattgtcggtagac
cacagagtgattgatggatatcctgcagccatgttcatgaaacgactgcagagactcctc
gaagctccttctgttttacttctcaattaa

DBGET integrated database retrieval system