KEGG   Chlamydia trachomatis A2497: CTO_0291Help
Entry
CTO_0291          CDS       T02094                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cra  Chlamydia trachomatis A2497
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CTO_0291
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CTO_0291
Enzymes [BR:cra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CTO_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(302156..303607)
Genome map
AA seq 483 aa AA seqDB search
MHLDQLLQNIPAKIYGKVESIPVRNLTRDSRCVGVGDIFIARQGQFCNGNDYSSQAVANG
AIAVLSSLYNPFLSVVQIIAEDPIALEASLAARFYNNPSRHLDVIGITGTNGKTTVSCLV
RELMERSGRRTGLIGTIEHILGENRIIDSFTTPDAILLQKYFAEMVKQNLSAAVMEVSSI
GMALGRVRETEFLAGVLTNITSDHLDFHGSLEEYIAAKKQFFASLPEKGIAVVNLDCEYA
PSFLNGSQARAVSYAIHQEADYRADRLKLYSSGSSYDIWYQGQVFPCETSLIGEHNVYNV
LASLAVVHQFLGRDFADLVRDVRFLSAPKGRLDPILLGPFPVYIDYAHTPDALDNVCRIL
LQLLPKDGRLIIVFGCGGDRDRVKRPLMAKVSEHYGFSFVTSDNPRTEDPDQIIADICKG
FSTDHYVVESDRKLAIEKAISMASDKDIVLVAGKGHEGYQIFKHQTIVFDDREVVCEALA
ALC
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatttagaccaacttcttcagaatattccggctaaaatttatgggaaagtcgagtct
attcctgttagaaatttgactcgagattctcgttgtgttggagttggtgatattttcatc
gctcgacaagggcagttttgcaatggcaatgactattcttctcaggctgttgcgaatgga
gcgattgcagttctctcttctctatacaatccttttttatcggttgttcagattatcgca
gaagatcctatagcattggaagcctctttggcagcaaggttttataataatccttcaagg
catctggatgtaataggaattacaggaactaatgggaagacaacagtctcctgtttggtt
agagaacttatggagcgttcaggaagaagaactggtcttattggaaccatagagcacatt
ttaggtgagaatagaattattgatagctttaccactcccgatgcgattttattgcagaag
tattttgctgaaatggttaagcagaacttatctgcagccgttatggaagtatcttctata
gggatggctcttggtcgagttcgtgaaacagagttcttagctggagttttaactaacatt
acttcagatcatttagattttcatgggtctcttgaagaatatattgcagctaaaaagcag
tttttcgcttccttgccagagaaaggtatagctgttgtcaatttggattgtgagtatgcg
cccagctttttaaatggttctcaggcaagagcagtctcctatgcaatccatcaagaagct
gattatcgagcagatagattgaagctgtattcatcaggatcttcttatgacatttggtat
caggggcaagttttcccttgtgagacatccttgataggagaacataatgtatataatgtt
ttagcatctttagctgttgtccatcaatttttaggcagagactttgctgatttagtacgc
gatgttcgtttcttatcagctcctaaaggacgtttggatccgattttattgggaccattc
cctgtttatattgattatgcccatactccagatgcattggacaatgtatgtagaatttta
ttacaactccttcctaaagatggtcggctaattattgtgtttgggtgtggtggagataga
gatcgtgttaagcgtcctcttatggccaaagtatctgagcattacggtttttcttttgtg
acttcagataatcctcggacagaagatccagaccagattattgctgatatatgtaaaggt
ttctcaactgatcattatgttgttgagagcgataggaagctagccatagagaaagcaata
tcaatggcttcagataaagatattgtactagttgcaggaaagggacatgaggggtatcag
atcttcaaacatcagacgattgtctttgatgatcgagaggttgtgtgtgaagccttggca
gccctttgttaa

DBGET integrated database retrieval system