KEGG   Chlamydia trachomatis A2497: CTO_0355Help
Entry
CTO_0355          CDS       T02094                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cra  Chlamydia trachomatis A2497
Pathway
cra00010  Glycolysis / Gluconeogenesis
cra00051  Fructose and mannose metabolism
cra01100  Metabolic pathways
cra01110  Biosynthesis of secondary metabolites
cra01120  Microbial metabolism in diverse environments
cra01130  Biosynthesis of antibiotics
cra01200  Carbon metabolism
cra01230  Biosynthesis of amino acids
Module
cra_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTO_0355
   00051 Fructose and mannose metabolism
    CTO_0355
   00562 Inositol phosphate metabolism
    CTO_0355
Enzymes [BR:cra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTO_0355
Exosome [BR:cra04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTO_0355
  Exosomal proteins of bladder cancer cells
   CTO_0355
  Exosomal proteins of melanoma cells
   CTO_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEP35171
UniProt: G4NMH7
Position
371570..372394
Genome map
AA seq 274 aa AA seqDB search
MFTDKETHRKPFPTWAHLLHSEPSKQFVFGNWKMNKTLTEAQTFLKSFISSDILSNPQII
TGIIPPFTLLSACQQAVSDSPIFLGAQTTHEADSGAFTGEISAPMLKDIGVDFVLIGHSE
RRHIFHEQNPVLAEKAAAAIHSGMIPVLCIGETLEEQESGATQDILLNQLTIGLSKLPEQ
ASFILAYEPVWAIGTGKVAHPDLVQETHAFCRKTIASLFSKDIAERTPILYGGSVKADNA
RSLSLCPDVNGLLVGGASLSSENFLSIIQQVDIP
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtttacagacaaagaaactcacagaaaaccatttccaacttgggcccaccttctccac
tctgagccatcaaagcaatttgttttcggtaattggaaaatgaacaaaacgcttactgaa
gctcagacctttttaaaaagtttcatctctagtgacattctgtctaatccccaaatcatt
acaggaatcattcctcctttcacactgctgtcagcttgtcaacaggctgtaagcgattcc
cccatctttcttggagcccaaaccactcatgaggctgactcaggagcttttactggtgag
atttcagccccaatgctcaaagatatcggagtcgattttgttctcatcggacattccgaa
agacgtcatatctttcatgaacaaaatcctgtacttgctgaaaaagctgctgcagctatc
catagtggaatgattccagttctgtgtattggagaaactctagaagaacaagaatctgga
gcaactcaagatattcttttaaatcaactgactataggattatctaaactccctgagcaa
gcctctttcattctagcttatgaaccagtctgggctataggcaccggaaaagtagctcat
cctgatctagttcaggaaacccatgctttctgtagaaaaacgattgcttctctcttttcc
aaagatattgcggaacgcacccccattctttacggaggatctgtgaaagccgataatgct
cgctcactttccctctgccctgatgttaatggtcttttagttggaggagcctctttatct
tcagagaatttcttatccattatacaacaagtcgatatcccataa

DBGET integrated database retrieval system