KEGG   Chlamydia trachomatis A2497: CTO_0665Help
Entry
CTO_0665          CDS       T02094                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cra  Chlamydia trachomatis A2497
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CTO_0665
   00670 One carbon pool by folate
    CTO_0665
Enzymes [BR:cra01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CTO_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(694397..694894)
Genome map
AA seq 165 aa AA seqDB search
MGWYVCMIQATGIVAIDPRGVMGALGKLPWSYPEDLRFFAETIRNHPIIMGRKTWESLPD
KYKHGRDIVVFSRRMHPPQCIGVSSFAEYGTLSLNHPFLIGGAELFESFFQQNLLKACFV
THIKKEYWGDTFFPITRLSGWKKECICNTEDFSIYYYENNSDQNT
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
ttgggctggtatgtttgtatgatccaagcaacaggtatcgttgctattgatcccagagga
gtgatgggagctttaggcaagctcccttggagttatcccgaagatctacgtttttttgca
gaaaccattcgaaatcatcccatcattatgggacgaaagacttgggagtctcttccagac
aagtataagcatgggcgggatatcgttgtcttttctcgcaggatgcatccaccacaatgc
ataggagtttcttcctttgcagagtatgggacactatctttgaatcatccgtttttaatt
gggggagcggagctctttgaaagttttttccaacaaaaccttctgaaagcttgttttgtc
acacatatcaaaaaggaatattggggcgatactttcttccctatcacgcgattatcagga
tggaagaaggaatgtatttgtaatacagaggatttcagtatttattattatgaaaataac
tccgatcaaaacacgtaa

DBGET integrated database retrieval system