KEGG   Chlamydia trachomatis A2497: CTO_0687Help
Entry
CTO_0687          CDS       T02094                                 

Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cra  Chlamydia trachomatis A2497
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTO_0687
Enzymes [BR:cra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CTO_0687
Exosome [BR:cra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTO_0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
722846..723874
Genome map
AA seq 342 aa AA seqDB search
MYNFMTRLPLLKRPRRNRKSAAVRSIIQETQLCSSDLIWPIFLKDGSGIREEIKSMPGVY
RWSLDMVSKELERLCTIGLKAVTLFPVIDANKKEQFGSYASHPYNIVCKGIQAIKKSFPE
LCVISDIALDPFTTSGHDGIFHNNYVINDESVRVYGGIAVMHAEMGADIVAPSDMMDGRV
KHIREQMDQMGFVNTGILSYSAKYASALYGPFRDALSSHLQSGDKRTYQMDPANVQEALL
ECQLDEEEGADMVMIKPAGFYLDVIVKARENTHLPVVAYQVSGEFSMIMAACLHGWLNKE
SVIKESLLAIKRAGATAIISYATPWVLEWLAKDALPFERSVL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgtacaactttatgacaaggcttccattactaaaacgacctcgcagaaaccgaaaaagt
gcagccgttcgatctataattcaagaaacccaactctgttctagtgacttgatctggccc
atctttcttaaagatggctctggaattcgagaagaaataaagagtatgcctggagtatac
agatggagtttagacatggtctctaaagagttagagagactttgtacgataggattgaaa
gctgttaccctctttcctgtaattgatgctaataaaaaagaacaatttggatcctatgcg
tcgcatccttacaacattgtttgtaaagggattcaagcgataaaaaaatcttttccagaa
ttatgtgtcatcagtgacatagctttagatccttttacaaccagtggtcacgatgggatt
tttcataataactacgttatcaatgatgaaagtgtccgtgtatatgggggtatcgctgtc
atgcatgcggaaatgggagcagatattgttgctcctagcgatatgatggatgggagagtg
aagcatattcgagagcagatggatcagatggggtttgtcaacacgggtattctctcgtac
agtgcaaaatatgcatctgcattgtatggcccatttcgggatgctctttcttcacatctt
cagtctggagataagcgtacatatcaaatggatcctgccaatgttcaagaagcgttgcta
gagtgtcagttagatgaagaagaaggcgctgatatggtgatgataaaacccgcaggtttt
tatctagatgtaatcgttaaagcgagagaaaacacccatcttccggtggtagcctatcaa
gtcagcggggaattttctatgattatggctgcttgccttcatgggtggttaaacaaagaa
agtgtaataaaagaatctttattagcgattaagagagctggtgcaacagctataattagt
tacgcaacaccatgggttttagaatggctagctaaagatgctcttccctttgagagaagt
gttctttga

DBGET integrated database retrieval system