KEGG   Chlamydia trachomatis A2497: CTO_0876Help
Entry
CTO_0876          CDS       T02094                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cra  Chlamydia trachomatis A2497
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CTO_0876
Enzymes [BR:cra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CTO_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
942388..943308
Genome map
AA seq 306 aa AA seqDB search
MLGEEILFFPTSFFYFLIMHFLSPAKLNLFLQILGRREDDFHEIVTRYQAIAFGDQLSLS
ISSRDSLQVINACHLETPSNSIWKSVALFRRYTGITTPVSWRVVKQIPVGAGLAGGSSNA
ATALFALNQIFKTGLSDEEMRSLAEQLGVDTPFFFSTGAALGVARGEKIIALEESVSDRY
VLYFSSEGVLTSRAFAAVQPSDCSSRKNLEYTQNDLEKPVFRLRLDLKEKKHWLESLWAE
LPVYIGLTGSGATLFVRYPEILEKDLSYAAQIQRAVTLSGGLLTSPIRRDPTAWYSIYSE
SALAAT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgttgggggaagagattcttttcttccccacctcttttttttattttttaattatgcac
tttctttctccagcaaagcttaatctctttttgcagatacttggcaggcgggaagatgat
tttcacgaaatagtcacacgctatcaagcgatagcctttggggatcaactctccttatca
ataagctctcgcgattctctccaagtaattaatgcttgtcatcttgaaacgcctagtaat
tctatatggaaaagtgtggcgcttttccgtcggtacacaggcattacaacgcctgttagt
tggcgtgtagtcaaacagatccctgttggagcaggtcttgcaggagggagtagtaatgca
gcaactgcattgtttgctttaaaccaaatcttcaaaacaggactatctgatgaggaaatg
cgttccttagccgaacagcttggcgtggatactccttttttcttttctacaggagcagcc
ttaggagtggcccgtggggagaaaataatagctctagaagagagtgtttcagatagatat
gttttgtatttttctagtgaaggagttctcactagtcgggcttttgccgccgtacaacct
tcggactgttcctccagaaaaaatttagagtatacgcaaaatgacttagaaaagcctgtt
tttcggttgcgcttagatttgaaagaaaagaaacattggctagaaagcctgtgggcggaa
cttcctgtgtatatagggctaacgggatcaggggcaaccttatttgtccgttacccagaa
atcttagagaaagacctttcttatgcagctcagatacaaagagcagtaacgttaagcgga
ggattattgacttctccgatacgaagagatcctactgcttggtatagcatctattctgaa
agtgcacttgcagctacataa

DBGET integrated database retrieval system