KEGG   Chlamydia trachomatis A2497: CTO_0895Help
Entry
CTO_0895          CDS       T02094                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cra  Chlamydia trachomatis A2497
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CTO_0895
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTO_0895
   00640 Propanoate metabolism
    CTO_0895
   00660 C5-Branched dibasic acid metabolism
    CTO_0895
Enzymes [BR:cra01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CTO_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
967445..968605
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLTAYQLPIPPYHVATSVPEVETAIQAEQWKAGVVKAQVHAGGRGKNGGV
VIAHSLEDLLAAADKLLHMQFSSNQTAGLSLPVDKVLISPLVEIASEYYLAIVIDRKHRC
PVIMLSKAGGVDIEEVAEKQPDQLLKMTLPSSGKIYGYQLRRIAKFMEWDQPIADQGNRI
IRQLLQCFYEKDASLLEINPLVLTKDGSLVILDAKMTIDDNALYRHPQLADCYDPSQENI
RDVLAKQLGLSYIALDGTIGCLVNGAGLAMGTLDILKLYGGSAANFLDVGGSASEKQIQE
AISLVLSDKSVRVLFIHIFGGIMDCAVVASGLVSAMQGQKETIPTVIRLEGTNVDKGKDM
IINAGIPCEFVTSMSEGAELTVQLSR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttcatgagtatcaagctaaggaccttttaactgcttatcaacttcctattccc
ccctatcacgtagcgacctccgtacctgaagtagaaacagcgattcaagccgaacaatgg
aaagctggtgttgtgaaagcacaggttcatgctggaggaagaggaaaaaatggaggggtg
gttattgcgcactctctggaagacttattagcagcagctgataagctactgcatatgcaa
ttttctagtaatcagacagcagggttgtctcttcctgtggataaagtattgatttcccct
ttagtagagattgcttcggagtattatcttgcgatcgtcatcgatagaaaacatcgttgt
cctgtcattatgctatctaaagcaggaggtgtggatatcgaggaagtcgcagaaaagcag
ccggatcagctgcttaaaatgacactaccttcttctggaaaaatttatgggtatcagtta
cgccgtattgctaagttcatggagtgggatcaacctattgccgatcaagggaatcgtatc
attcgccagttattacaatgtttttatgaaaaggatgcttctttattagagattaatcca
ttggtacttactaaagacgggtctcttgtcattctggatgccaaaatgacgattgatgac
aatgctctttatcgacatcctcagctagcagactgctatgatccttctcaggaaaatatt
cgtgacgtactagctaagcagttaggcctttcatacattgctctagatggaacaatcgga
tgtttagtcaatggtgcaggattagcgatgggcaccttagatattctgaagttatatggc
ggttctgctgccaatttcttagatgtaggaggaagtgcttctgaaaagcaaattcaagaa
gccatctctttagtcttatctgataaaagtgtgcgcgtgctctttatccatatttttggg
gggattatggattgtgcagtcgtcgcttctggacttgtttctgctatgcaaggacagaaa
gaaacgatccctactgtaattcggttagaagggacgaatgtagataaaggaaaggacatg
attattaacgcaggaattccttgtgagttcgttacatccatgagcgagggggctgaactc
actgtgcaattaagtcgttag

DBGET integrated database retrieval system