KEGG   Capsella rubella: CARUB_v10001382mgHelp
Entry
CARUB_v10001382mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
crb  Capsella rubella
Brite
Enzymes [BR:crb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CARUB_v10001382mg
Peptidases [BR:crb01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   CARUB_v10001382mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 336 aa AA seqDB search
MSWLPVESDPGVFTEIIQQMQVKGVQVEELYSLDINSLDEIRPVYGLILLYKWRPDEKEN
RVVIMEPNPNFFFASQIINNACATQALLSVLMNSSSIDIGSELSELKEFAKEFPPELKGL
AINNNEAIRAAHNSFARPDPSSNMEEEELAAAKNVDEDDYLYHYISYLPVDGIIYELDGL
KEGPISLGQCLGEPEGIEWLRMVQPVVQERINRYSQNGIRFSLLAVVKNRKELYVAELKE
YQRQRERILQQLGGLQADKYAEKSSYEALDRSLSEVNIGIETVSQKIVMEEEKSKNWKKE
NMRRKHDYVPFLFNFLKILADKKKLKPLIDKAKCNP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcttcctgtagaatctgatcctggtgttttcactgagattatacaacaaatg
caagtgaaaggtgtgcaggttgaggaattgtattccttggacattaattcgcttgatgaa
ataagacctgtatatggattgatattgctttacaagtggcgaccagatgaaaaggagaac
cgtgttgtcatcatggaaccaaacccgaatttcttctttgcaagccagataatcaacaat
gcttgtgcgacccaagcgttgttatcggttctcatgaactcttcgagtatcgatattggc
tcagaactatcagaactgaaagaattcgccaaagagtttccacctgaactgaaaggttta
gccatcaacaacaatgaggcgatacgtgcagctcacaactcatttgccaggcctgaccca
tcttccaacatggaagaagaggaattagctgctgcgaaaaatgtagacgaagatgattat
ctatatcattacatcagctacttacctgttgatggtatcatatatgagctcgatggtcta
aaagaaggacccattagtcttggacagtgtctgggtgagccagaaggaatcgagtggctc
agaatggtccaacctgtggtacaagagcggattaaccggtattcgcagaatgggattcgg
tttagtctcttagctgtagttaagaacaggaaagagctgtatgtagctgaactgaaagag
tatcagagacagcgagagaggattttgcagcagttaggtggtttgcaagctgataaatac
gctgagaaaagcagttatgaggctctcgatagatctctttctgaagtcaatatcgggata
gagaccgtttcacagaagattgtaatggaggaggagaagtctaagaactggaagaaagag
aacatgagaaggaaacacgactatgtccctttcctcttcaatttccttaagattcttgct
gacaagaagaagctgaaacctctcattgataaggctaagtgtaacccctaa

DBGET integrated database retrieval system