KEGG   Capsella rubella: CARUB_v10004897mgHelp
Entry
CARUB_v10004897mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
crb  Capsella rubella
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CARUB_v10004897mg
Enzymes [BR:crb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CARUB_v10004897mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 422 aa AA seqDB search
MTSLHALLFTCLLFFFIFPTFTLSTLLFQSFNWESWKKQGGFYNSIHNSIDDIANAGTTH
IWLPPPSQSVSPEGYLPGKLYDLNSSKYGSETELKSLIQALNQKGIKAVADIVINHRTGA
TRDDKCGYCYFEGGTSDDRLDWDRSFVCRNDPNFPGTGNIDTGGDFNGAPDIDHLNPRAQ
RELSEWMNWLKSDIGFHGWRLDFVIGFASSIAKLYVQNTSPDFAVGEKWDDMKYGGDGKL
DYNQDQHRYGLKQWVEEAGSGVLTAFDFTTKGILQSAVQGELWRLKDSQGKPPGLIGIMP
GNAVTFIENHDTFRTWVFPSDKVLLGYVYILTHPGTPCIFYNHYMEWGLKESISKLVAIR
KRNGIGSTSSVAIKAAESDLYLAMIDDKVIMKIGPKLDLGTLVPSNFALAYSGLDFAVWE
KK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgacttctctccatgcgttactcttcacttgtcttcttttcttcttcatcttcccaaca
ttcacactttccaccttactgtttcagagtttcaattgggaatcgtggaagaaacaagga
gggttctacaattctatccacaactccatcgacgacatagccaacgctggaaccactcat
atttggcttcctcctccttctcaatccgtttctcctgaagggtacttaccggggaagctg
tacgatctgaacagttctaaatacggttcagagacggaattgaaatcgctaatccaagca
ctgaatcaaaaaggaataaaagctgtggctgatatagtgatcaaccacagaaccggtgcg
acaagagacgataaatgcggatactgttatttcgaaggtggcacttccgatgatcgtctt
gactgggatcgttcattcgtctgccgcaatgaccctaactttcccggtaccggaaacatc
gacactggaggagatttcaatggggcgccagacatcgaccacctcaaccctagagctcag
agagagttgtcagaatggatgaactggcttaaatctgatatcggattccatggttggaga
ctcgatttcgttataggttttgcatcttccatcgccaaattatacgttcagaacacttca
ccggactttgcggtgggtgaaaaatgggacgatatgaagtatggaggagatggaaaactg
gactataaccaggaccagcatcggtatggtctcaaacagtgggttgaggaagctggtagt
ggtgtcttgacagcttttgacttcacgaccaaagggatcttacagtctgcagtccaaggt
gagctctggagactaaaagactctcagggaaaaccgcctggtctgatcgggatcatgccc
ggtaacgctgtcacattcattgaaaaccacgacactttcaggacgtgggttttcccttct
gataaagtcttgcttggatacgtttatattcttactcatccgggaactccttgcattttt
tataatcattacatggaatggggactaaaagagagcatatccaagttggtggctataagg
aaaagaaatgggattggtagcacaagctctgttgcgatcaaagcagcagagtcggatctc
tacttggctatgatcgatgataaggttatcatgaagatagggccaaagctggatttggga
actctcgttccttctaactttgctttagcttattcaggccttgactttgctgtctgggag
aagaagtga

DBGET integrated database retrieval system