KEGG   Capsella rubella: CARUB_v10009190mgHelp
Entry
CARUB_v10009190mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
crb  Capsella rubella
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    CARUB_v10009190mg
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     CARUB_v10009190mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 432 aa AA seqDB search
MAETVHSPIVTYASMLSLLAVCPPFVILLWYTMVHQDGSVTKTSNYFWENGVQGLINIWP
RPTMIAWKIIFCYGAFEAALQLLLPGKRVEGPISPAGNKPVYKANGVAAYFVTLATYLGL
WWFGIFNPSIVYDHLGEIFSALIFGSLIFCVLLYIKGHVAPSSSDSGSCGNLIIDFYWGM
ELYPRIGKNFDIKVFTNCRFGMMSWAVLAVTYCIKQYEMNGKLSDSMLVNTILMLVYVTK
FFWWEAGYWNTMDIAHDRAGFYICWGCLVWVPSVYTSPGMYLVNHPVELGTQLAIYILIA
GVLCIYINYDCDRQRQEFRRTNGKCTVWGRAPSKIVASYTTTSGETKTSLLLTSGWWGLA
RHFHYVPEILSAFFWTVPALFDNFLAYFYVIFLTILLFDRAKRDDDRCRSKYGKYWKLYC
EKVKYRIIPGIY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcggagactgtgcattctccgatcgttacttacgcatcgatgctttcgcttctcgcc
gtctgtccacctttcgtcattctcctatggtacacaatggttcatcaggatgggtctgtt
actaagacctctaactacttttgggagaatggagttcaaggactcatcaacatatggcca
agacccactatgattgcttggaagataattttctgctatggagcatttgaggctgctctt
cagctgcttctgcctggtaaaagagtcgagggtccaatttctccagctgggaacaaacca
gtttacaaggccaatggtgtggctgcttactttgtgaccctagccacctatcttggtctt
tggtggttcggaatcttcaacccttcaatagtctatgatcacttgggtgaaattttttca
gcacttatcttcggaagcctcatattttgtgttttgttgtacattaagggtcatgttgca
ccttcatcaagtgactctggttcatgtggtaaccttattattgacttctattggggcatg
gagttgtaccctcgaattggtaaaaactttgacatcaaggtttttactaattgcagattt
ggaatgatgtcttgggcagttcttgcagtcacgtactgcataaaacagtatgaaatgaat
gggaaactatctgactcaatgctggtgaacaccatactgatgctggtgtatgtcacaaaa
ttcttttggtgggaggctggttattggaacaccatggacatcgcacatgaccgagctggc
ttctacatttgctggggttgtctggtgtgggtgccttctgtatacacctctccaggcatg
taccttgtgaaccaccctgtcgaacttggaactcagttggcaatatacattctcattgca
ggagtcctttgcatttacataaactatgactgcgatagacaaaggcaagagttcaggagg
acaaatgggaaatgtacggtttggggcagagccccgtcaaagattgtggcatcgtatact
acaacatctggtgaaactaaaactagtctgctcttaacatctggatggtggggattggct
cgtcatttccattatgttcctgagatcctaagtgctttcttctggactgtaccggctctc
ttcgataacttcttggcatacttctacgtcatattcctcaccatacttctcttcgatcga
gctaagagagacgatgacagatgccgatcaaagtatgggaaatattggaagctgtattgt
gagaaagtgaaatacaggatcattccgggaatttattga

DBGET integrated database retrieval system