KEGG   Capsella rubella: CARUB_v10009429mgHelp
Entry
CARUB_v10009429mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
crb  Capsella rubella
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CARUB_v10009429mg
Enzymes [BR:crb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CARUB_v10009429mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 383 aa AA seqDB search
MMKGVSLSQFTNFNPTNIEFDRLRKLQINTLYPNPTQSRCSRPLSRRSLRVLSLSVDPSA
NRNVKSAIEAHAPPLVVVGSANADIYVEIERLPKEGETISAKTGQTLAGGKGANQAACGA
KLMYPTYFVGRLGEDAHGKLIAEALGDAGCGVHLDYVRSVNDEPTGHAVVMLQSDGQNSI
IIVGGANMKAWPETMSDDDLEIVRTAGIVLLQREIPDSINIQVAKAVKKAGVPVILDVGG
MDTPIPNELLDSIDILSPNETELSRLTGMPTESFEQISQAVAKCHKLGVKQVLVKLGSKG
SALFIEGEKPIQQSIIPAAQVVDTTGAGDTFTAAFAVAMVEGKSHEECLRFAAAAASLCV
QVKGAIPSMPDRTSVLKLLKSSI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggggtttcactttctcaattcaccaattttaatcctacgaacatcgaattc
gatcgactcaggaagcttcagatcaacactctctatcctaatccaacacaatctcgatgt
tcccgccctctttccagaagatccctccgtgttctctcgctctccgtcgatccatcggcg
aatcggaatgttaaatcagctatcgaagcccatgcgccgcctctggtcgttgtgggatct
gcgaacgccgacatctatgtggagatcgagagattgcccaaggaaggggaaacgatttcg
gccaagacagggcaaacgctcgccggaggaaaaggcgcgaatcaggcggcgtgtggagcg
aagcttatgtatccgacttacttcgttggccgtttgggtgaggacgcgcatggtaagctt
attgccgaggcgttgggcgatgctgggtgtggtgttcatctggattacgtgcgatcggtg
aacgatgagccgacggggcacgccgtcgtcatgcttcaatcggacggtcagaattcgatc
attatcgttggtggtgctaatatgaaagcttggcctgagacaatgagtgatgatgatctt
gagatcgtgaggactgctggtattgtcctgcttcaaagggagatcccagattccatcaat
attcaagttgctaaggctgtgaagaaagcaggtgttcctgtcatccttgatgttggagga
atggatacgccaatccccaatgagttattggattccattgacatcttgagtccgaatgaa
actgagctcagtcgcttgaccgggatgccaactgaatcttttgaacagattagccaagct
gttgcaaagtgccataagttgggagttaagcaagtcctagtgaaactcgggtccaaagga
tctgcactattcatagaaggggaaaaaccaatccagcagtctataataccagctgcacaa
gtggtcgatactacaggagctggggatactttcacagctgcatttgcagtggctatggta
gagggcaagtcccatgaggaatgcttgagatttgctgctgcagctgcctctctttgtgtc
caagtaaagggtgcaataccgagcatgcccgaccgaacatcggtcttgaaactccttaaa
tctagtatctaa

DBGET integrated database retrieval system