KEGG   Capsella rubella: CARUB_v10009877mgHelp
Entry
CARUB_v10009877mg CDS       T02984                                 

Definition
(RefSeq) hypothetical protein
Organism
crb  Capsella rubella
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 299 aa AA seqDB search
MGDTTKEDGTSQSKSLRRGKRAYFFRKWTRIDLMRASAVGAVHVLCLLAPFNFKWEALRF
GVILAVVTSLSITFSYHRNLTHRSFKLPKWLEYPFAYSALFALQGHPIDWVSTHRFHHQF
TDSDRDPHSPIEGFWFSHVFWIFDTSYIREKCGGRNNVMDLKQQWFYRFLRNTIGLHIIA
FWTLIYFWGGLPYLTCGVGVGGAIGYHGTWLINSACHIWGSQAWNTKDTSRNVWWLGLFT
MGESWHNNHHAFEASARHGLEWYQVDITWYLIRFFQALGLATDVKLPTDAQKRKMAFAR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgggggacaccactaaggaagatggcaccagccagagcaaatcgctgcgtaggggaaag
agagcctactttttcaggaaatggacgcggatcgatctgatgagggcttcggctgttggg
gctgtgcatgtattgtgtctgttggctccgtttaacttcaaatgggaagctctccggttt
ggtgtgattcttgccgtagtgactagtctcagcattacattctcataccataggaacttg
actcaccggagctttaagcttcctaaatggctagaatatccattcgcttactctgccctc
tttgcgcttcagggtcatccgatagattgggtgagcacgcataggttccatcaccagttt
acagattcagaccgtgacccacatagccctattgaaggattctggttcagtcacgtcttt
tggatattcgacaccagctacatcagagaaaagtgtggaggacgtaataacgtgatggac
ttgaagcaacaatggttctataggttccttcgaaacaccattggtctccacatcatagca
ttttggaccctcatctatttctggggtggtcttccttacctaacttgcggcgtgggagtt
gggggagcaataggataccatgggacatggctcataaactcggcgtgccatatttgggga
tcgcaagcgtggaacaccaaggacacctctcgtaacgtttggtggctagggctattcacg
atgggagagagctggcacaacaaccaccatgcctttgaggcgtcagctaggcacggactg
gaatggtatcaggtagacataacttggtacctgatcaggttcttccaggctcttggctta
gccaccgatgtcaaattgcctacggatgctcagaaacgcaagatggctttcgctcgttag

DBGET integrated database retrieval system