KEGG   Capsella rubella: CARUB_v10012304mgHelp
Entry
CARUB_v10012304mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
crb  Capsella rubella
Brite
Enzymes [BR:crb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CARUB_v10012304mg
Transcription factors [BR:crb03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    CARUB_v10012304mg
Mitochondrial biogenesis [BR:crb03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    CARUB_v10012304mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1578 aa AA seqDB search
MKTIPQSSVAVSASAPQQLATSDLSKLRNVMRLKILAFLAPRIKTSGSESDKAANYQKRA
KQYTVFVDDILWSNAQSLKDYADQNTLKARCDNVVRRCLLRPPPNAATPSSVAMMNGCVT
ATRPLDTFQSGCPPPVTCTNGVSAGFSFGTDHMQMQQYSASAGANNFNHQMVDIYRPNVN
QFTCGVSSPLITGAGFSSNCGVPLPNGPMASQELFTTPTHLSALSQPFPQPPDQSNMHRY
SMSNVASFGTTNPYGVVMPSVSMAVSQHSVPWNSNPMLQGVDSTVTSNLQGMQQYPLPKR
QLHQALWNNQFQSASTNQDHLAHGFHQQAPDTDHQGLHSQNLYSGQLDKDAYLTQQAMGL
AAPVINNGPSLDSYEEALHRQVTTNGFKPSKLQCQQAAVKDHYIGAQSASVHGSQMNSSP
FFQPRPQQQQSASVPVQRRQPSLQKSTGISENYDGQRGHTVVNLCQSSAMQPEPVHRLSS
PIPHISSQTVSPRNTVESKHLGDGNGTTPVNGDCGQAHKNVQRWLVFMIHVRKCKARKDK
CATEYCFQGKKMWKHICFCKLPDCTYSYCLPTRKWIHHYKKCGQKTCTVCGYVKNYKEKN
KEISVALRRAKYSSGSSKCQPRKSSKSRQACKKGGAEAPSVDADLQPSVKRRKVQRPSQN
AIPVTKNISVTGSGVVCKPHSSMNMKKKNGLKSDDCKSVRPVVMPMDIDVPDACGIPVTR
ELEKQVAEDTPKGINCGGFTKDDKTSCLLAQGKSKCMNEVSASKEEGKSKCMNEVSAPKE
EENVKQSVEVVDASKMEISSLVELFSPEQVKGHIRSLRQWVGQSKTKADKNKAMGCTMSE
NSCQLCAVERLVFEPIPVYCSPCGVRIKKNALHYYCVVAGESRHYVCSPCYNEAHENLVS
LDGTSIPKASLEKKKNDEQVGEGWVQCDKCEAWQHQICALFNSRRNHGEATKYTCPNCYI
QELEQGERRPLPPSAIPGAKDLPVTALSNHIEERLFKKLKEERQERARLQGKFFEEVPGA
ESLTVRVVASVDRVVEVKESFLEIFREENYPSEFPYKSKVILLFQEIENVEVCLFGMFVQ
EFGTECGPPNQRPEVRTVSGEALRTFVYHEILIGYLDYCKKRGFTSCYIWACPPIKGEDY
ILYCHPEIQKTPKNDKLREWYLAMLRKAAKEDVVVECTNFYDHFFVQSGECRANVTAARL
PYFDGDYWPGAAEDLIRQMNQEGDGAVPNRKGLTKKVISKRALRAFGQLDLSVNASKDRL
MMQKLGETICPMKEDFIMVHLQHCCKHCSTLMVSGNRWVCNQCKNFQICDKCNEVEQNRI
EKERHPINHKEKHTLFPMAIEDVPAEIKDKDDNLESEFFDNRQSFLNLCQGNNYQYDTLR
RAKHSSMMILYHLHNPTAPAFATFCTICQQEVESSQGWHCEVCPNYDVCSACYSNASINH
SHKLISRSSSADTSAVQHNRQTNQNYQAVMKKVKELLLHMAACRSTTLCKYHGCRKMKLL
SRHSLACKTGPGGCPYCKRFWSILRLHARSCRDSQCTVTKCRELRDISSRQQQQSDKRRR
AAVIEMMRERAAEASRTR
NT seq 4737 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgattcctcagagctctgttgccgtatcggcatcggctcctcagcagctggct
actagtgacttgagcaagttgcgtaatgttatgcgattaaagattttggctttcttagca
ccaaggataaaaacaagtggttcagagtctgataaagccgccaactaccaaaagcgtgcc
aaacaatacacagtttttgtagatgatatactctggagcaatgcccaatcattgaaggac
tacgccgatcaaaatactcttaaagcccgctgtgataatgtggtcagacgctgtttgctg
cgccctcctcctaatgctgctactccaagttctgttgccatgatgaatggatgtgttaca
gccacccgccctctcgatactttccaatccggatgcccaccgccagttacttgcaccaac
ggagtttctgcagggttttcttttgggactgatcacatgcagatgcagcaatattctgct
tctgctggtgcaaataactttaatcaccagatggttgatatttataggccaaatgtgaac
cagtttacttgtggggtctctagccctctgattactggcgcaggttttagcagcaactgt
ggtgtaccacttcctaatggacctatggcttctcaagagctcttcactactcctacccat
ttgtcagctttgtctcaaccttttccgcaacctcctgatcagtcaaacatgcatagatac
tcaatgagcaacgttgcttcttttgggacaaccaatccctatggagttgttatgccttct
gtatcaatggcagtttctcagcattcagttccatggaactccaatcctatgcttcaggga
gttgactccaccgtcacaagtaatctgcaaggaatgcaacagtatccattgcccaaacgt
caactgcatcaggctctgtggaataatcagttccaatctgcttccactaatcaagatcat
ttggctcacgggtttcaccagcaagctcctgatactgaccaccaaggactacattctcaa
aatctttactctggtcaacttgacaaggatgcttatctcactcagcaagctatgggttta
gctgctcctgtcattaataatggaccaagcttagattcatacgaagaagctcttcacaga
caggttactacaaatggtttcaaaccgtccaagttgcagtgccaacaggctgctgttaaa
gaccactatattggtgctcaaagtgcatctgtccatggtagtcagatgaattcttctcca
tttttccaaccacgtcctcaacaacagcagtcggcatcagtcccagttcagaggaggcag
ccatctctacagaaatcaactggaatatcagaaaactatgatggacagagaggacatact
gtggtaaacttatgtcaaagtagtgctatgcagcctgaacctgttcatcgtttatcatct
ccaataccgcatataagcagccaaactgtttctcctaggaacacagttgagagcaaacat
cttggggatggaaacggtacaacaccggtaaacggagattgtggtcaagcgcataagaac
gtgcagcggtggcttgtgtttatgatccatgtacgtaagtgcaaggcaagaaaagataag
tgtgccaccgagtattgcttccaaggcaaaaagatgtggaaacatatatgcttctgcaag
ctccctgattgcacatatagctattgtcttccaactcggaaatggattcatcattacaag
aagtgcggacaaaaaacgtgcactgtctgtggatatgtcaaaaactacaaggaaaagaac
aaagaaataagtgtagctctccgtagagctaagtatagctcaggtagttcaaaatgtcag
cctaggaaatcctcaaaatccaggcaagcatgcaagaaaggaggtgctgaagctccatct
gttgatgctgatctgcaaccctcagtgaagcgccgcaaggtacagcgaccctcccaaaat
gccattcccgtgacgaagaacatttcagtgacaggaagtggtgttgtatgtaaacctcat
tcctcaatgaatatgaaaaagaaaaatggtttgaaaagtgatgactgcaaaagtgtcaga
cctgtggttatgcccatggacatagatgttcctgatgcttgtggcattcccgttacccgg
gaactggagaagcaagttgctgaagatactcccaagggtataaactgtggtggtttcaca
aaggatgacaaaactagttgcttattggcacaaggaaaatccaaatgtatgaatgaagtg
agtgcatcaaaggaagaagggaaatccaaatgtatgaatgaagtgagtgcaccaaaggaa
gaagagaatgtgaaacagtctgtggaagttgtagatgcttctaaaatggaaatctcatca
ctcgttgagttatttagtccagagcaagtaaaggggcatatccgcagtcttcgtcagtgg
gtaggccagagtaaaacgaaggcagacaaaaacaaagcaatggggtgcaccatgtctgag
aattcttgccagttgtgtgctgttgagaggcttgtatttgagccaatacctgtttactgc
tcgccatgtggtgtacgcatcaagaaaaatgccttgcactattattgtgttgtggctggt
gagtcaaggcattatgtctgttcaccttgctacaatgaagcgcatgaaaacttggtttct
cttgatggaacttctataccgaaagcaagtcttgagaaaaagaaaaatgatgaacaagtt
ggagaagggtgggtgcaatgtgacaagtgtgaagcctggcagcatcaaatatgtgctttg
ttcaacagcagaagaaatcatggcgaggccaccaagtacacttgccctaattgctatata
caagagctggaacaaggcgaaagaagaccattaccaccgagtgccattcctggagcaaaa
gatttaccagttactgctcttagcaaccatatagaggagcgcttattcaaaaagttgaag
gaggaaagacaggagagggctagacttcaagggaaattttttgaggaggtccctggagcc
gaatcacttactgtcagagttgtggcatcggttgacagagtagtagaagtaaaggaaagt
ttccttgagattttccgagaagaaaattatccttctgaattcccatataagtccaaggtc
atattgttgtttcaggagattgaaaatgtggaagtgtgcttgtttggcatgttcgtccag
gaatttggaacagagtgtggacctcccaatcaaagacctgaggttcgaacagtgtctgga
gaagccctccgcacgtttgtgtaccatgaaattctgattggttatctcgactattgcaag
aaacgcggttttacaagctgctatatatgggcatgccccccaataaagggtgaagattac
attctttattgtcatcctgaaatccagaagacgccaaagaatgataaactaagggaatgg
tatttagcaatgttaaggaaggctgcaaaagaagatgtggtcgtcgaatgcacaaacttc
tacgatcatttctttgtccaatctggcgaatgtagagctaatgtaactgctgcaaggttg
ccatattttgatggagactactggccaggtgctgctgaggatttaatacgtcaaatgaac
caagaaggtgatggtgcggttccaaatagaaaaggattgaccaaaaaggtcatatcgaaa
agagctcttagagcttttggccagttggacctttctgttaacgcctcaaaggatcgactg
atgatgcaaaaactcggtgagaccatttgtccgatgaaggaagattttataatggttcat
ctgcaacattgctgcaagcattgtagcactctcatggtatctgggaaccggtgggtgtgc
aatcagtgcaagaattttcagatatgtgacaagtgtaatgaagtggaacagaaccgcata
gagaaagagagacatcccataaatcataaagagaaacacacgctattccctatggccatc
gaggacgttcccgcagagattaaggacaaagacgacaacctcgagagcgagttctttgat
aatagacaatctttcctgaatctttgccaaggaaataactatcagtacgacactctaagg
cgggcgaaacactcttccatgatgattctctatcatcttcacaacccaactgcccctgca
tttgccaccttttgcacgatctgccaacaagaagttgaaagctctcagggatggcactgt
gaagtttgtccaaactatgatgtctgcagtgcctgttactctaacgcgtctatcaaccat
tcacataaactgataagtcgttcctcttctgcggatactagtgctgtacaacacaacagg
caaactaatcaaaactatcaagccgtgatgaagaaggtaaaagaactgctgctacatatg
gctgcatgccgctctacaacactgtgcaagtatcatggttgtcgtaagatgaagttgctc
tccagacattctttagcatgtaagactggtcctggaggttgcccttattgtaagagattt
tggagtatcctcagactccatgcccgcagctgtagagattcccagtgcactgtcaccaaa
tgcagagagctcagagatattagtagtaggcagcagcagcagtcagacaaaaggcgtaga
gctgctgtaatagagatgatgcgggaaagggccgctgaagcctcccgcactcgctga

DBGET integrated database retrieval system