KEGG   Capsella rubella: CARUB_v10012899mgHelp
Entry
CARUB_v10012899mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
crb  Capsella rubella
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CARUB_v10012899mg
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CARUB_v10012899mg
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CARUB_v10012899mg
Enzymes [BR:crb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CARUB_v10012899mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 968 aa AA seqDB search
MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL
YELSAEYEGKREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK
KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYYNQIENLMFELSMWRCTDEFRARADELHRNSRKDAAKHYIEFWKT
IPPTEPYRVILGDVRDKLYHTRERSRQLLSNGISDIPEEATFTNVEQFLEPLELCYRSLC
SCGDRPIADGSLLDFLRQVSTFGLSLVRVDIRQESERHTDVLDAITKHLGIGSSYRDWSE
EGRQEWLLAELSGKRPLFGPDLPKTEEIADVLDTFKVISELPSDCFGAYIISMATSPSDV
LAVELLQRECHVKKPLRVVPLFEKLADLEAAPAAVARLFSIDWYKNRINGKQEVMIGYSD
SGKDAGRLSAAWELYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDT
VNGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPISPKPEWRALLDEMAVV
ATEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQ
TRFHLPVWLGFGAAFRFAIKKDVRNLHMLQDMYKNWPFFRVTIDLIEMVFAKGDPGIAAL
YDKLLVSEDLWAFGEKLRANFEETKNLVLQTAGHRDLLEGDPYLKQRLRLRDSYITTLNV
CQAYTLKRIRDPNYNVTLRPHISKEIMQSSKSAQELVKLNPTSEYAPGLEDTLILTMKGI
AAGLQNTG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcggaacgtagagaagatggcatcgattgatgctcagcttcggcaacttgtt
cctgctaaagtcagtgaagacgataagcttattgagtatgatgctcttctcctcgatcgt
tttctcgacattctccaggatttacacggcgaggatctccgtgaaacggttcaagagcta
tacgagctttctgctgagtatgaagggaagcgtgaacctaagaagcttgaggaactaggg
agtgttctaacgagtttggatcctggtgactccattgttatctccaaggctttctctcac
atgcttaacttagccaacttggctgaagaggtgcagattgctcaccgccgcaggatcaag
aagctcaagaagggtgatttcgttgatgagagctctgcaactactgaatccgatatcgaa
gagacgttcaagagactcgtttctgatcttggcaagtctcctgaagagatatttgatgcc
ctgaagaatcagactgtggatttggttttgactgctcatcctactcagtctgtgcgtaga
tcattgcttcaaaagcatgggaggataagagactgtcttgcccaactgtatgcaaaggac
attactcctgatgacaagcaggagctcgatgagtctctgcaaagagagattcaagctgca
ttccgtaccgatgagattagaagaacacctccaaccccacaagatgaaatgagagctgga
atgagttatttccacgagacaatttggaatggtgtccccaagttcttgcgtcgtgtggat
acagctctgaaaaacattgggattgatgaacgtgtcccttacaatgccccattgatccaa
ttctcttcatggatgggcggtgatcgtgatggtaatccgagggttacacctgaggtcacc
agagatgtgtgcctgttggctagaatgatggctgcaaatctctattataaccaaatcgag
aacctgatgtttgagttgtctatgtggcgttgcactgatgagttccgtgcccgggctgat
gaactccacaggaactcaaggaaagatgcagcaaaacactacatagaattttggaagaca
attcctccaactgagccatatcgtgtgattcttggtgatgtgagggataaactgtatcac
acacgtgagcgctctcgtcaattgctgagtaacggaatctctgacattcctgaagaagct
actttcaccaatgtggaacagttcttggagcctcttgagctctgttaccgttcactttgt
tcatgtggtgaccgcccaatagctgatggaagccttcttgatttcttgaggcaagtctct
acctttggactctcccttgtgagagttgacattaggcaagagtctgaacgccacacagat
gtcttggatgctatcaccaagcatttgggcatcggttcctcctatagagactggtctgaa
gaaggccgacaggaatggcttctagctgaactaagtggaaagcgtccacttttcggacct
gatcttcccaaaaccgaagaaattgctgatgtcctcgacacattcaaagtcatatctgag
cttccttcagactgttttggagcttacattatatctatggcaacttcacctagtgatgtg
cttgcggttgagcttttgcagcgtgaatgccatgtgaaaaagccacttagagttgttcca
ctctttgagaagctagctgatcttgaagcagctcctgcagccgttgctagactcttttct
attgactggtacaaaaaccgtattaacggtaaacaagaggttatgatcggttactcagat
tcaggcaaagatgcaggacgtctctcagctgcttgggagctatacaaagctcaagaagag
cttgtgaaggttgctaaggaatatggagtgaagctgacaatgttccatggccgtggtggc
acagtcggaagaggaggtggtcccactcatcttgctatattgtctcagccgccggataca
gttaatggctctcttcgagtcacagttcagggtgaagtcattgagcaatcatttggagag
gaacatttatgctttagaacacttcagcgtttcacagctgcaactttagagcacggaatg
aaccctccaatttcaccaaaacctgaatggcgtgctttgctggatgaaatggcggttgtt
gcaactgaggaataccgatctgttgttttccaagaacctcgatttgtcgagtacttccgc
ctggctactccggagctggagtatggacgtatgaacattggaagtagaccttcaaagcgg
aaaccaagcggtgggattgaatctctccgtgcaatcccatggatttttgcatggacgcaa
acaagatttcatcttcccgtatggttaggtttcggagcagcttttaggtttgcgattaag
aaagatgtgcgaaacctccacatgctgcaagatatgtacaagaactggccatttttccga
gtcaccattgatctaattgaaatggtgttcgccaagggagaccccgggattgctgctttg
tacgacaaacttcttgtctcagaagatttatgggcttttggagagaaactcagagccaac
tttgaagaaaccaagaacctcgtcctccagactgctggacatagagatcttcttgaagga
gacccttacttgaaacagagactgaggctgcgtgactcttacattacgaccctcaacgtt
tgccaagcgtacacattgaagaggatccgtgatccaaactacaatgtgaccctgcgacca
cacatttccaaagagatcatgcaatcaagcaagtcagcacaagagctcgtcaagcttaac
ccaacgagtgaatacgcgccaggacttgaggacacactcatcttaaccatgaagggtatc
gccgcaggattgcaaaacaccggttaa

DBGET integrated database retrieval system