KEGG   Capsella rubella: CARUB_v10012912mgHelp
Entry
CARUB_v10012912mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
crb  Capsella rubella
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CARUB_v10012912mg
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CARUB_v10012912mg
Enzymes [BR:crb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CARUB_v10012912mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 950 aa AA seqDB search
MVGATLFHRRKHSWPPEEFISRSTLQLLDFDSAAPPAHAWRRKLNCHANLLKEFTITFRE
AIKMVRLGIRLWSYVREEASHGRKAPIDPFTKENCKPSASQGVPLGGMGSGSISRGFRGE
FKQWQITPGTCDPSPMMSNQFSIFISRDGGHKKYASVLSPGQHGSLRKSHDKGISSWGWN
LNGQHSTYHALFPRAWTIYDGEPDPELKISCRQISPFIPNNYRDSSLPAAVFVYTLVNTG
KERAKVSLLFTWANSMGGTSHMSGGHVNEPFIGEDGVSGVLLHHKTGKGNPPVTFAVAAS
ETQNVNVTVLPCFGLSEDSSFTAKDMWDTMEKDGKFDQENFNSGPSTPSLAGDTICAAVS
ASAWVEAHGKCTVSFALSWSSPKVKFSKGSTYDRRYTKFYGTSPRAALDLVHDALTNYKR
WEEDIEAWQNPILRDERLPEWYKFTLFNELYFLVAGGTVWIDSASLDSNRSSHHQQSGFG
NSDGKASGLDINDQHNNLGNGNSVGTKSNGEVSAIHNRNGLFVDTRHVDDGDDVGRFLYL
EGVEYVMWCTYDVHFYASYALLMLFPKIELNIQRDFAKAVLSEDGRKVKFLAEGNVGIRK
VRGAVPHDLGMHDPWNEMNAYNIHDTSKWKDLNPKFVLQVYRDFAATGDYQFGIDVWPAV
RAAMEYMEQFDRDNDDLIENDGFPDQTYDTWTVHGVSAYCGCLWLAALQAAAAMALQIGD
KFFAELCKNKFLNAKAALEKKLWNGSYFNYDSGASSNSKSIQTDQLAGQWYAASSGLPPI
FEESKIKSTMQKIFDFNVMKTKGGKMGAVNGMHPDGKVDDTCMQSREIWTGVTYAAAATM
ILSGMEEQGFTTAEGIFTAGWSEEGFGYWFQTPEGWTTDGHYRSLIYMRPLAIWGMQWAL
SLPKAILDAPQINMMDRVHLSPRSRRFSHNVKVVKHKAKCFGNSALSCSC
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggtaggggcaactttgtttcaccgtagaaagcattcatggccgcctgaggagttcatc
agtagaagtaccttgcaattacttgattttgatagtgctgctccaccagcacacgcatgg
aggaggaagttaaactgtcatgccaatttactaaaagagttcactattacgtttagggaa
gcaattaaaatggtacgcttggggatacgattgtggtcttatgtccgagaagaggcctct
catggaaggaaagcacctattgatcctttcaccaaagagaactgcaaaccatctgcatcc
caaggtgttccactcggaggaatgggaagtggaagcatatctaggggattccggggtgaa
tttaagcagtggcaaattacacctggaacttgcgatccatcacctatgatgtctaatcag
ttctcaatttttatttctcgagatggtggacacaaaaagtatgcatcagttttgtctcca
ggccagcatggaagtctaagaaaatcgcatgataaaggtatttcttcatggggatggaat
ctgaatggccagcattcaacttatcatgctctattccctcgggcttggactatatatgat
ggtgagcctgatccagaattaaagatttcatgccggcaaatatctccctttataccaaac
aattaccgagatagtagtcttccagcagctgtttttgtatatactttggtgaacactgga
aaagaaagggcaaaagtcagcctccttttcacttgggcgaattcaatgggtgggacttca
catatgtcaggaggtcatgtgaacgagccattcataggcgaagatggggtctccggtgtc
ctcttacatcacaagacaggcaagggaaatcctccggttacatttgcggttgctgcttct
gagacgcagaatgttaatgtaactgttttaccatgctttggactgtctgaagatagttct
tttacagcgaaagatatgtgggatacaatggaaaaggatggaaaatttgatcaagaaaac
ttcaatagcgggccaagcacaccttcattagctggagacacgatttgtgcagcagtgtca
gcttcggcatgggtagaagctcatggcaagtgcactgtgtcttttgctctttcatggtcg
tcaccaaaagtgaaattttcaaagggaagcacatatgacaggagatacactaaattttat
ggaacttcgccaagagcagcactggaccttgtgcatgatgcactgacaaattacaagagg
tgggaggaagatattgaggcatggcaaaatcccattctcagagatgaaagactccctgag
tggtacaagttcactctgtttaatgagctttactttttggttgctggtggtacagtttgg
atagactctgcttcactcgattccaataggagtagtcatcatcaacaatcgggtttcgga
aattcagatggtaaggcgagtggacttgacattaatgatcaacacaataaccttggtaat
ggcaacagcgttggaacaaaaagcaatggtgaagtatcagctattcataaccggaatggt
ttatttgtcgacactcggcatgtagatgatggcgatgatgttggccggtttctgtatttg
gaaggtgtggagtatgtgatgtggtgtacgtatgatgtacacttttatgcatcatatgcg
ctccttatgctattcccaaagattgaactaaacatccagcgagattttgcgaaagctgtg
ttgtctgaagatggaaggaaggttaagttcctggcagaaggaaatgttggaattcgcaag
gtcagaggtgcggttcctcacgatctggggatgcatgatccgtggaatgaaatgaatgcc
tacaacatacatgacacaagcaagtggaaagatcttaacccaaagtttgttcttcaggta
tatagagattttgcagccacaggagattaccaatttggaatagacgtctggcctgcagtt
cgtgctgctatggagtacatggagcaatttgatagagacaatgacgatctaatagaaaat
gatggtttcccagatcagacatatgatacatggactgttcatggcgttagcgcctattgc
ggttgcctgtggcttgctgctcttcaagctgcggcggcaatggctctccaaatcggtgac
aaattctttgctgagttgtgtaagaataagtttttgaatgcaaaggcagcactggaaaag
aaactctggaacggatcatacttcaattacgacagtggggcaagcagcaacagcaaatct
atacagactgatcagctggctggtcaatggtatgctgcatcttcaggtctgcctcctata
tttgaggaatccaaaatcaaaagcactatgcaaaagatctttgattttaatgtgatgaag
accaaaggaggcaaaatgggtgctgtaaatgggatgcatcctgatgggaaagtggatgat
acgtgcatgcagtcacgtgagatatggacaggtgttacttacgcagctgcagctactatg
atcctctctggaatggaagaacaaggattcaccactgctgagggaattttcacagctggc
tggtcagaagaaggttttgggtattggttccagacaccggaaggttggacaacggatggg
cattacaggtcattgatatacatgagaccgctcgctatatggggaatgcaatgggcctta
tctctgccaaaggcaattctcgacgctcctcagataaacatgatggacagagttcactta
tcacctagaagcagaagattctctcacaacgtcaaagtcgtaaaacacaaggctaagtgt
tttggcaactcagcgttaagctgttcctgctga

DBGET integrated database retrieval system