KEGG   Capsella rubella: CARUB_v10016482mgHelp
Entry
CARUB_v10016482mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
crb  Capsella rubella
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CARUB_v10016482mg
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CARUB_v10016482mg
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CARUB_v10016482mg
Lipid biosynthesis proteins [BR:crb01004]
 Desaturase
  First
   CARUB_v10016482mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 364 aa AA seqDB search
MVCLSTTPKQLSLFPPLVKQRNPRNSNALFTLNIHNSTSSFWTTRGGPVAHTKHTVVAVY
DAPDQVEGSRKIPFSKVLVVRKQRSFRERSWTSWDVTKLVIFVGIHLLSLLAPFYCSWKA
FWAFLWLVYINGICITFSYHRNLSHRSFDLPKWLEYLFAYGGVLAFQGDPIEWVSNHRYH
HKHCETQRDPHSPTQGFWFSHMAWIFDTGYILEKCGGEENVQDLVRQPFYRFLQRTVLLH
IMAYALLFYFCGGMPLLVWGIGVAIVVRLHLTFLVNSACHIWGTRAWNTPDFSKNNWWVA
ILTLGEGWHNNHHAFEFSARHGLEWWQLDITWCFIRFLEAIGLATNVKLPTESQKKIMNL
VHDG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtctctctacaactcccaaacagctttctctttttccaccacttgttaaacaa
cgtaacccaagaaatagcaatgcattgttcacacttaacatacataactctacaagctct
ttttggaccacacgaggaggacccgtggctcacacgaaacacacggtcgtggctgtttat
gatgcaccagatcaggttgagggctcccggaagatacccttctcgaaggttttggtggtg
agaaaacagaggtcatttcgggaaaggagttggacttcttgggacgtgaccaagttagtc
atattcgtcgggattcatttgctgagtcttttggctccattttactgcagttggaaggca
ttttgggctttcctttggctcgtttacatcaatggaatatgcatcacgttttcttatcat
aggaacctttcacaccgaagttttgatctgccgaaatggctcgagtatctctttgcttat
ggtggcgttctggcttttcagggagacccaatagagtgggtgagcaaccatcggtaccat
cataagcactgtgagacacaacgtgatccacacagtcctacgcaagggttttggtttagt
catatggcatggatatttgatacgggctatatactcgaaaagtgtggtggagaggagaat
gtacaagaccttgtaaggcagcccttctataggttccttcagcgaaccgtgcttttgcat
ataatggcttatgcccttctcttctatttttgtggaggcatgcctttactcgtctgggga
attggtgttgcaattgtggttcgactccacctgacttttctcgtgaactcagcttgccat
atatggggaacacgagcttggaatacacctgacttctccaagaacaactggtgggtagcg
attttaacacttggcgagggatggcataacaatcatcatgcgttcgagttctcggccagg
catggactggaatggtggcagctcgacattacttggtgtttcattaggtttcttgaagct
attggtttggccactaacgttaagttaccaactgaatctcaaaagaaaataatgaatttg
gtccatgatgggtaa

DBGET integrated database retrieval system