KEGG   Capsella rubella: CARUB_v10016868mgHelp
Entry
CARUB_v10016868mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
crb  Capsella rubella
Brite
Enzymes [BR:crb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CARUB_v10016868mg
Transcription machinery [BR:crb03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CARUB_v10016868mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 607 aa AA seqDB search
EARIFRSSASSFPPPNYTSKTLDSRFRHDLLNHLHFSASMDSHSSHLNAANRSRSSQTPS
PSHSASASVTSSLHKRKLAATTAANAAASEDHAPPTTSFPPSSFSADTRDGALTSNDELE
SISARGADTDSDPDESEDIVVDDDEDEFAPEQDQDSSMRTFTAARLDSNSGVNGSSRNTK
LKTESSTVKLESSDGGKDGGSSVSGTGVSGIVGGSSISGLVPKDESVKVLAENFQTSGAY
IAREETLKREEQAGRLKFVCYSNDCIDEHMMCLVGLKNIFARQLPNMPKEYIVRLLMDRK
HKSVMVLRGNLVVGGITYRPYHSQKFGEIAFCAITADEQVKGYGTRLMNHLKQHARDVDG
LTHFLTYADNNAVGYFVKQGFTKEIYLEKDVWHGFIKDYDGGLLMECKIDPKLPYTDLSS
MIRQQRKAIDERIRELSNCQNVYPKIEFLKNEAGIPRKIIKVEEIRGLREAGWTPDQWGH
TRFKIFNCSADMVTNQKQLNALMRALLKTMQDHADAWPFKEPVDSRDVPDYYDIIKDPID
LKVIAKRVESEQYYVTLDMFVADARRMFNNCRTYNSPDTIYYKCATRLETHFHSKVQAGL
QSGAKSQ
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
gaagccagaatattccgttcgtcggcgtcgtctttcccgcccccaaattatacgagcaaa
accctagactctcgatttcgtcacgatttgctcaatcaccttcacttttctgcttcaatg
gactcccactcttcccatctcaacgcggccaaccgttcgcgcagctctcaaactccttct
ccttctcattcggcctccgcttccgtcacttcttctctccacaagcgcaagctcgccgcc
accaccgcggcgaatgcagccgcctctgaagaccacgctcctcctactacctctttccct
ccttcctccttctctgccgatactcgcgacggtgccttgacctccaacgacgaactcgag
agcatctcagctcgcggcgctgatacggattcagaccctgatgaatctgaggatatcgtc
gttgacgatgatgaggacgaatttgctcctgagcaggatcaagactcttcaatgcgcact
ttcacggccgctcgactcgattccaattctggagtcaatggttcaagtcgcaacactaag
ctgaagacggagagctccactgtgaagcttgagagctctgatggtggaaaagatggtgga
tcatctgtgtctgggaccggtgtgagtggaatcgtaggaggaagctcaatctcagggctg
gtgccgaaggatgagtctgttaaagtattggctgagaattttcagacaagcggagcttac
attgcgagagaagagactttgaagagagaggagcaagcaggacgactcaaatttgtttgt
tactcaaatgactgcattgatgagcatatgatgtgcttggttggattgaagaacatattt
gcaagacagttacctaacatgcccaaggagtacattgtccgtcttctgatggacaggaaa
cacaagtctgttatggtcctaagaggaaatctagttgtaggtggtatcacgtatcgtcca
tatcacagtcagaagtttggggaaatagcattttgtgcaatcacagcagatgaacaagta
aaaggttacggtaccagattgatgaaccacttgaaacaacatgcacgtgatgttgatgga
ttgacacattttcttacttatgcggacaacaatgctgttggttattttgtcaagcagggt
tttactaaagagatttacttggagaaagatgtatggcatgggttcattaaagattatgat
ggtggcctcctaatggaatgcaaaattgatccaaagcttccatatacggatctgtcaagc
atgatacgccagcaaagaaaggcaattgatgaaaggataagagagttatcaaactgtcag
aatgtgtatccaaaaattgagtttctaaagaatgaagctggaattcctagaaagattatc
aaagttgaggaaatacgtggcttaagagaagctggttggacaccagatcagtgggggcat
acacgtttcaaaatattcaactgttctgcagatatggtgacaaatcaaaaacagttgaat
gcacttatgcgcgcacttttgaagacaatgcaagaccatgctgatgcttggccattcaaa
gaaccagttgattctcgtgatgtccctgattactatgacatcattaaagatcccattgat
ctgaaggtaattgcaaagagggtagagtcggaacagtattacgtgacactcgacatgttt
gttgctgatgcgagacggatgtttaacaattgtagaacttacaactcccctgataccatt
tattacaaatgtgcaaccaggttggaaactcacttccatagcaaagtacaagcaggtctc
cagtctggtgctaaatctcaatag

DBGET integrated database retrieval system