KEGG   Capsella rubella: CARUB_v10018939mgHelp
Entry
CARUB_v10018939mg CDS       T02984                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
crb  Capsella rubella
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CARUB_v10018939mg
Enzymes [BR:crb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     CARUB_v10018939mg
Peptidases [BR:crb01002]
 Serine Peptidases
  Family S33
   CARUB_v10018939mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 310 aa AA seqDB search
MYKEDYVLNSRGIQLFTCSWKPEEQQEPKALIFLCHGYAMESSITMNSTAMRLAKAGFAV
YGMDYEGHGKSGGLNGYVRKFDDLVLDVSSHYSSICEREESKGKMRFLMGESMGGAVVLL
LARKKPGFWDGAVLVAPMCKLAEDIKPHPMVISFLTKLTRFIPTWKIVPNNDIIDVAFKE
SHIRKQVRENEYCYKGRPRLKTAHQLLMVSLDLEKNLHQVSMPFIVLHGEDDKVTDKNVS
KLLYEVASSSDKTFKLYPNMWHGLLYGEPPENLEIVFADIISWLNERASVPNQRSEAELK
HMNDGFSMHK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagaggattatgtattgaactcacgagggatacaacttttcacgtgttcatgg
aaaccagaggagcagcaagaaccaaaggctttaatctttctctgtcatggctacgccatg
gaatcaagcatcaccatgaacagcactgcaatgaggttggccaaggcaggattcgccgtc
tacggtatggactatgaagggcatggtaaatccgggggattaaatggttacgtcagaaag
tttgatgatcttgttcttgacgtctcttctcattactcttcaatttgcgagagggaagag
agtaaggggaagatgaggtttctaatgggagaatcaatgggaggagcagtcgtgttactg
ctagcgagaaagaagcctggtttttgggacggtgctgttttggtcgcccccatgtgtaag
ttggcagaagacataaagccacatcctatggtgatctcatttctcacaaagctaactcgg
tttattccaacttggaagatagttcctaacaacgatattattgatgtggcttttaaagaa
tcccacattcgaaaacaggtaagggaaaacgagtattgctacaagggccgacctcgcttg
aaaaccgctcaccaactcttaatggttagcttggatcttgaaaagaatcttcatcaggta
tcaatgccgtttattgtccttcacggtgaagatgataaagttacggacaaaaatgtaagc
aagctactatacgaggtggcttcgagttcggacaagactttcaagttatacccgaacatg
tggcatgggcttttatacggggaacctcctgagaatttggagattgtgtttgctgatatc
ataagctggttaaacgagagagcttctgtcccaaaccaaaggtcggaggctgagttaaag
catatgaatgatggcttttctatgcataaataa

DBGET integrated database retrieval system