KEGG   Capsella rubella: CARUB_v10022329mgHelp
Entry
CARUB_v10022329mg CDS       T02984                                 

Definition
(RefSeq) hypothetical protein
  KO
K01757  
strictosidine synthase [EC:4.3.3.2]
Organism
crb  Capsella rubella
Pathway
Indole alkaloid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    CARUB_v10022329mg
Enzymes [BR:crb01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.2  strictosidine synthase
     CARUB_v10022329mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 311 aa AA seqDB search
MRPKYIDNQSFQKLPVPGNRTGPEAFAFDSTGKGFYTGVSGGKILKWLPGKGYVDFAHIT
NSSTSSLCDGALATANAEKCGRPAGIAFNGKTGDLYVADAPLGLHVISRGGGLAKKIADS
VDGKPFLFLDGLDIDPTTGVVYFTSFSSAFGPRDVLKAVASKDSTGKLFRYDPSKKVVNV
LMEGLSGSAGCAVSSDGSFVLVSQFTKSNIKRYWIKGSKAGSSEDFTNSVSNPDNIKRIG
SSGNFWVASVVNSATGPTNPSAVKVSSDGKVLQTIPLKDKFGDTLVSEVNEFKGKLYIGA
LFGPFAGILKV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgaaatatatagacaatcaatcttttcaaaaacttccggtgccggggaacagg
acaggacctgaagctttcgcctttgattccaccggaaaaggattctacactggagtctcc
ggtggtaaaatcctcaagtggcttccagggaaaggttatgtcgattttgcacacatcacc
aactcttcaacgtcgtctttgtgcgacggagcacttgcaaccgctaacgcagaaaaatgt
ggtcgcccggcgggaatagctttcaacggcaaaacaggtgacctttacgttgccgatgct
ccgttgggtctccacgtcatctctcgcggcggcggtttggccaagaagatcgccgacagc
gttgacgggaagcccttcttgtttctcgacggtctcgacattgatcccactaccggtgtc
gtctatttcacttccttcagctcagcttttggccctcgcgatgtattgaaagcagtggca
tcaaaagactcgacggggaagcttttcagatacgatccatcaaaaaaggtcgtgaatgta
ttgatggaaggtctaagtggctcagccggatgtgcggttagctcagacggctcgttcgtg
ctggttagtcagttcacaaaaagtaacatcaagaggtattggatcaaaggatctaaagct
ggctcttctgaagacttcaccaactcggtctcgaaccctgacaatatcaagagaatcggt
tcttctggaaacttttgggttgcttcggtcgtgaactcagccaccggacccacgaaccct
tcggcggttaaggttagttctgatggcaaagtgcttcagaccattcctcttaaagataag
tttggggatactttggtcagcgaggttaacgaattcaaaggaaagctttatattggcgct
ttgtttggtcctttcgccgggattcttaaggtttag

DBGET integrated database retrieval system