KEGG   Capsella rubella: CARUB_v10024771mgHelp
Entry
CARUB_v10024771mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
crb  Capsella rubella
Brite
Enzymes [BR:crb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CARUB_v10024771mg
Peptidases [BR:crb01002]
 Cysteine Peptidases
  Family C86
   CARUB_v10024771mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 313 aa AA seqDB search
MAESESQIYHERQRLQFCLLHSLNNLFQEKDAFTRENLNSIAEKLVDDDPNKETWTPLSL
LLKPHHNTLTGNYDVNVMITALEGKGKSVVWHDKRSGASSIDLNDADALMGIVLNVPVKR
YGGLWKSRHWVVVRRINGVWYNLDSDLVVPQMFKDEDEVRGFLDQNLSLGGEPQVSSKVS
AIYKATGTKRFNANTRPVTPGKQSSVKGPYGKNPRCTTSCGLRLPRKTECTAARLIKHFS
CNFVKGLRLVVMRTKKKKRSPPLKKASSSGISQSSVISIVNDTHRSEAIEDCIQFINSST
SFTRSSSTSDGKS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatccgaatctcagatctatcacgaacgacaacgattgcaattttgccttttg
cactccctcaacaatctatttcaggaaaaagacgcattcacgcgagaaaacttgaactca
atagcagagaagctcgtggacgatgatccaaacaaagaaacatggacacctctctcttta
ctcctcaagcctcatcacaatacactcactggtaactacgacgtaaacgtgatgattaca
gctcttgaaggcaaaggcaagagtgttgtttggcatgataagcgtagtggagcttcttcc
attgatcttaatgatgcagatgctttaatgggtattgtgttgaatgttccggttaagcga
tatggtggtctgtggaaaagtagacattgggttgtggttagaagaatcaatggggtttgg
tataatttggatagtgatctcgtcgtgccacagatgttcaaagatgaagatgaagtaaga
gggttcttggatcaaaatctgagtttaggtggagagcctcaagtctcaagtaaggtatct
gcaatttataaagctacaggaacaaaacggttcaatgcaaacactagaccagtaactcct
ggtaagcaatcctcagtaaagggaccatatggtaagaatccgagatgcacaacaagctgt
ggtttgaggctaccgaggaaaacagaatgcacagcagcaagactgatcaaacatttcagc
tgtaactttgttaagggcttacgactggtggtgatgaggacgaagaagaagaagagatct
ccaccattgaagaaggcttcttcttctggtatatctcagtcttcggtcatctctatcgta
aatgatactcacagatcagaggcgatagaagactgcatacagtttataaactcatcgacc
tcgtttacgagatcaagttctaccagtgacggtaaatcataa

DBGET integrated database retrieval system