KEGG   Capsella rubella: CARUB_v10026199mgHelp
Entry
CARUB_v10026199mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
crb  Capsella rubella
Brite
Enzymes [BR:crb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     CARUB_v10026199mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 540 aa AA seqDB search
MNQSYRNRVQVLYYMIYDCELDTHITIQSLKLKRSYITTSEFPDYIFRKKERSPLLFIYT
SRRCSCPKEKTNLMSLGYAEKLSFIEDVGQVGMAEFFDPSHVLQCKIEELAKMIQKSKHL
VVFTGAGISTSCGIPDFRGPKGIWTLQREGKDLPKASLPFHRAMPSMTHMALVELERAGI
LKFVISQNVDGLHLRSGIPREKLSELHGDSFMEMCPSCGAEYLRDFEVETIGLKETSRRC
STEKCGAKLKDTVLDWEDALPPKEIDPAEKHCKMADLVLCLGTSLQITPACNLPLKCLRG
GGKIVIVNLQKTPKDKKANVVIHGLVDKVVAGVMESLNMKIPPYVRIDLFQIILTQSLSG
DQRYINWTLRVASVHGLASQLPFIKSIEVSFSDNHKYKDAVLDKQPFLMKRRTTRNEAFD
IFFRVNYSDGCDCVSTQLSLPFEFKASTEEHGEIIDKEAVLQSLRDKAVEESGCGQSGVV
ERRAVSEPRSEAVVYATVTSLRTFHCEQSLLAANGDLKWKLEGSGTSRKRSRTGKRKSKT
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatcataccggaaccgagtccaagttttgtactatatgatttacgactgtgaa
cttgacacacatattaccattcaaagtctgaaactaaagagatcgtatatcacaacttca
gaatttcctgattacatttttagaaaaaaagagagatcccctctgctttttatatataca
tcgagaaggtgttcttgtccgaaagagaagacaaatctaatgtctttaggttacgcagag
aaattgtccttcattgaagatgttggtcaagtcggcatggccgagttcttcgacccatct
catgttctacaatgcaagatcgaagaacttgctaagatgattcaaaagagtaagcatcta
gtagtcttcacaggtgctggtatttctacttcttgtggtattcctgatttccgagggcct
aaaggaatttggacgttacagcgcgagggcaaagatttacccaaagcatctctgccattt
catcgtgcaatgccaagcatgactcatatggctttggttgaattagaaagagctggcatt
ttaaaatttgtcatcagtcagaatgtagacggcttacatcttcgatctggaataccaaga
gagaaactttcagaactgcatggagactcttttatggagatgtgcccatcatgtggagca
gagtacctgcgtgatttcgaggtggaaactattggattgaaggagacatcaagaagatgc
tccactgaaaagtgtggagccaaacttaaagatacggtcttagactgggaggatgcttta
cctccaaaagagattgatcctgcagagaagcactgcaaaatggctgatcttgtactttgt
ttgggtaccagtttgcagataacccctgcttgcaatttgcctctcaagtgtctcagaggt
ggagggaagatcgtcatagttaatcttcagaaaaccccaaaggacaagaaagcaaacgta
gtgattcatggtcttgttgataaggtggttgcgggggtcatggaatcacttaacatgaag
attcctccatatgtcaggattgatcttttccagataattctaactcaatctttaagcgga
gatcagaggtatattaattggacactgcgcgttgcaagtgttcatggattggcttctcag
ttaccattcatcaaatctatcgaggtttctttctcagataaccataagtacaaagatgcg
gttcttgataagcagccgtttcttatgaaaaggagaacaacacgaaatgaagcttttgat
atattcttcagagttaactacagtgacggttgtgactgtgtctccactcaacttagcctc
ccatttgaattcaaggcctcaacagaagagcatggagagattattgacaaggaggctgtg
ctacaaagcctgagagacaaagcggttgaagaatctggttgcgggcaaagcggcgtggtt
gagagaagagcggtttctgaaccgagaagtgaggctgttgtgtatgctactgtcactagt
ctcaggactttccattgtgaacagtctctgcttgctgctaatggagacctcaaatggaag
ctggaaggttcgggaacgtctcgtaaacgttcaagaaccggcaaacgaaagtcaaagaca
tag

DBGET integrated database retrieval system