KEGG   Capsella rubella: CARUB_v10026402mgHelp
Entry
CARUB_v10026402mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
crb  Capsella rubella
Brite
Enzymes [BR:crb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CARUB_v10026402mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 445 aa AA seqDB search
MGSSANTETAIVSASPASNHNNPGTNGGDAHTNHTPAAILDLVVSEPESSKKRRTGVLPL
EVGTRVMCQWRDGKYHPVKVIERRKNYNGGHNDYEYYVHYTEFNRRLDEWIKLEQLDLDS
VECALDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELG
KYEIETWYFSPFPPEYNDCVKLFFCEFCLSFMKRKEQLQRHMRKCDLKHPPGDEIYRSST
LSMFEVDGKKNKVYAQNLCYLAKLFLDHKTLYYDVDLFLFYILCECDDRGCHMVGYFSKE
KHSEEAYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLVSYRGYW
TRILLDILKKHKGNISIKELSDMTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDRH
LKAAGRGGLDVDVSKMIWTPYKEQS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgtctgcgaatacagagacggcgattgtctccgcctcaccggcgtcgaaccac
aataatcccggtaccaacggtggagatgcgcatacgaatcatactcctgctgcgatactc
gatctcgtcgtctcagaaccggaatcgtcgaagaagagaagaacaggggtgcttccgctc
gaggttggtactcgcgtgatgtgtcaatggagagacgggaagtaccatccggtgaaggtt
atcgagcgccggaagaattataatggtggccacaatgactacgagtattacgttcactac
acagagtttaatagaagattggatgaatggattaagctggagcagctagaccttgattca
gtagagtgtgctttagatgaaaaagttgaagacaaggtgactagcttgaagatgacacga
caccagaaacggaagattgatgagactcatgtagagggtcatgaagagctggatgctgca
agtttacgagaacacgaggaattcacgaaagtgaagaacatagcaacgattgagcttggg
aaatatgaaattgagacatggtacttttctcctttcccgccagaatacaatgactgcgtg
aagctctttttctgtgagttttgcctcagttttatgaaacgcaaagagcagcttcaaagg
catatgagaaaatgcgatctgaagcacccccctggggatgaaatctatcgaagttctact
ttgtcaatgtttgaggtggatggcaagaagaacaaggtctatgcacagaacctctgttat
ctggccaagctatttcttgaccacaaaactctttactatgatgttgatttgttcctattt
tatattctctgcgaatgtgatgatcgtggatgtcacatggttggatacttttcaaaggag
aaacactctgaagaagcttacaacttggcttgcatcctcacccttcctccttatcaaagg
aaaggctacggaaaattcttaatcgccttctcctatgaactctcaaagaaagaaggcaaa
gtcgggacaccagagcgacccctctctgatcttggcttagtgagttacagaggatactgg
actcggattttattagacatcttgaaaaagcacaagggaaacatatctatcaaggagctg
agtgacatgacagcaatcaaagcagaagatatattaagcacccttcagagtttggaactg
atacagtacaggaaaggacaacacgtgatctgcgcagatcctaaggtactggatagacat
ttgaaggcggcaggccgaggaggccttgatgtagatgttagcaaaatgatctggactcct
tacaaagagcagagctaa

DBGET integrated database retrieval system