KEGG   Capsella rubella: CARUB_v10027976mgHelp
Entry
CARUB_v10027976mg CDS       T02984                                 

Definition
hypothetical protein
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
crb  Capsella rubella
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:crb00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    CARUB_v10027976mg
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     CARUB_v10027976mg
    1.1.1.234  flavanone 4-reductase
     CARUB_v10027976mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 326 aa AA seqDB search
MVSQKETVCVTGASGFIGSWLVMKLLERGYFVRATVRDPGNLKKVNHLLDLPNAKTQLTL
WKADLSEEGSYDDAIKGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGILKACVKAKTV
RRFVFTSSAGTVNVEEHKKSVYDEQDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEE
KGLDFISIIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNAHIF
LYEHNAAKGRYICSSHDATILTISKFLRQKYPEYNVPSTFEGVDENLKSIKFSSKKLTEM
GFNFKYSLEEMMVESIETCRQKGFLP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcagaaagagactgtgtgtgtaaccggtgcttcggggttcattggttcatgg
ctagtgatgaagttacttgaacgtggttactttgttcgtgctactgttcgtgatcctggg
aatttgaagaaagtgaaccatcttcttgacttgccaaacgccaagacgcaacttactttg
tggaaggctgatttatccgaggaaggaagctacgacgacgccattaaaggatgtgacggt
gtttttcacgtggctactcccatggattttgaatctaaagatcctgagaatgaagtgata
aaaccgacagtgaatggaatgttggggatattgaaagcatgtgttaaggcaaagaccgta
cgaagatttgtgtttacttcatctgccggaactgttaatgtcgaagaacataagaagagt
gtctatgatgaacaagattggagtgatcttgagtttatcatgtccaagaaaatgacagga
tggatgtacttcgtgtcgaaaacactagccgagaaagcagcgtgggattacgccgaggaa
aaaggcttagatttcattagcattattccaacattggtggtcggtccattcatcacaaca
tctatgccgcctagcctcatcaccgcgctctctcccatcactcggaatgaggctcattac
tcgatcataagacaaggacagtatgtgcatttggacgacctatgtaacgctcatatcttc
ttgtacgaacacaatgctgccaagggacgttatatttgttcctctcacgatgcaaccatt
cttactatctccaaattcctcaggcaaaagtaccccgaatacaatgtaccttcaacgttt
gaaggtgttgatgagaatctaaagagcattaagttcagttccaagaagcttactgaaatg
gggtttaacttcaagtatagcctcgaggaaatgatggttgaatcgatcgaaacatgtcga
caaaaggggtttctcccg

DBGET integrated database retrieval system