KEGG   Corynebacterium resistens: CRES_0096Help
Entry
CRES_0096         CDS       T01538                                 

Gene name
echA2
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
crd  Corynebacterium resistens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CRES_0096 (echA2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CRES_0096 (echA2)
   00650 Butanoate metabolism
    CRES_0096 (echA2)
  Lipid metabolism
   00071 Fatty acid degradation
    CRES_0096 (echA2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CRES_0096 (echA2)
   00310 Lysine degradation
    CRES_0096 (echA2)
   00360 Phenylalanine metabolism
    CRES_0096 (echA2)
   00380 Tryptophan metabolism
    CRES_0096 (echA2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CRES_0096 (echA2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CRES_0096 (echA2)
   00281 Geraniol degradation
    CRES_0096 (echA2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CRES_0096 (echA2)
   00627 Aminobenzoate degradation
    CRES_0096 (echA2)
   00930 Caprolactam degradation
    CRES_0096 (echA2)
Enzymes [BR:crd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CRES_0096 (echA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(122333..123118)
Genome map
AA seq 261 aa AA seqDB search
MGSMAEYETILTETNGRVATITLNRPKALNALNSQLLADVTAAVETFDAQENIGAIVITG
GEKAFAAGADIKEMKDETFPEIRDKRLFAEWEKLAAVKTPIITAVSGFALGGGCEVAMIG
DILLASETAKFGQPEITLGVIPGMGGTQRLTRAVGKYKAMDLILTGRMMDADEAERSGLV
SRVLPAEGFDEEVQKIAAKVASMSTVATAAATEMVDEAYQSTLTEGLESERQAFWGLFAS
EDQKEGMNAFVEKRKPEWKHR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggatccatggctgaatacgaaacgattttgaccgaaaccaacggccgcgtggccacg
attacgttgaaccgacccaaggcgctgaacgcgctgaatagccagctattggctgatgta
accgctgcagtggaaacgttcgacgcgcaagaaaacattggtgccatcgtgatcaccggc
ggtgagaaagctttcgccgccggtgctgatatcaaagaaatgaaggatgaaacgttccct
gaaattcgggataagcgtctatttgcagagtgggagaagctcgctgcggtaaaaacccca
atcattactgcggtgagcggtttcgctctcggtggcggctgcgaggtagctatgatcggc
gacattttgttggctagcgagaccgcaaaattcggtcagcccgagatcacgctgggagtg
attccaggcatgggtggtacccaacggctgacgcgcgcggttggtaagtacaaggcgatg
gatttgatcctcactgggcgcatgatggacgctgatgaggccgaacgcagtggcctcgta
tctcgagtgcttcctgctgagggtttcgacgaagaagttcagaagatcgccgccaaggtg
gcttccatgagtactgtagctacagccgctgcgacggaaatggtggatgaggcctaccag
tcgactctgactgaggggttggaatccgagcgtcaagcgttctggggattgtttgcttct
gaggatcagaaggaaggtatgaatgccttcgtggagaagcgcaagcccgagtggaagcac
cgctag

DBGET integrated database retrieval system