KEGG   Corynebacterium resistens: CRES_0183Help
Entry
CRES_0183         CDS       T01538                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
crd  Corynebacterium resistens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CRES_0183 (folE)
Enzymes [BR:crd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CRES_0183 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223416..223946
Genome map
AA seq 176 aa AA seqDB search
MLFAVGENPDREGLKDTPARVARAYEEIFAGLYTDPTEVLDKTFNEDHRELVLVRDIPFY
STCEHHLVPFFGHAHIGYIPGTSGKVTGLSKLARLIDGLAKRPQVQERLTSQVADALVER
LEASAVIVVIEAEHLCMAMRGIRKPGANTVTSAVRGGFRTNASSRAEAMALIQRGR
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
ctgcttttcgcagttggagaaaacccggatcgggaggggctgaaggacactccagcccgt
gttgcccgcgcctatgaagaaatctttgccgggttgtacaccgacccaaccgaagtgctg
gataagacctttaacgaggatcaccgcgagctcgttctcgttcgcgacatcccgttttat
tcgacgtgtgaacaccacctcgtgccttttttcgggcacgctcacattggctatatcccg
ggcacctcgggcaaagttaccggcctttccaagctcgcgcgcctcatcgatggccttgcc
aagcgcccccaagtgcaagaacggctgacgtcccaagtcgcggatgctttggtggaacgc
ctcgaagcctccgcagtcatcgtcgtcattgaagctgaacatctttgcatggccatgcgc
ggcatccgcaaacccggtgcgaacacggtcacttctgcggttcgaggcggtttccgcacg
aatgccagttcccgcgcagaagccatggctttgattcaacgaggccgctaa

DBGET integrated database retrieval system