KEGG   Corynebacterium resistens: CRES_0183Help
Entry
CRES_0183         CDS       T01538                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
crd  Corynebacterium resistens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:crd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223416..223946
Genome map
AA seq 176 aa AA seqDB search
MLFAVGENPDREGLKDTPARVARAYEEIFAGLYTDPTEVLDKTFNEDHRELVLVRDIPFY
STCEHHLVPFFGHAHIGYIPGTSGKVTGLSKLARLIDGLAKRPQVQERLTSQVADALVER
LEASAVIVVIEAEHLCMAMRGIRKPGANTVTSAVRGGFRTNASSRAEAMALIQRGR
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
ctgcttttcgcagttggagaaaacccggatcgggaggggctgaaggacactccagcccgt
gttgcccgcgcctatgaagaaatctttgccgggttgtacaccgacccaaccgaagtgctg
gataagacctttaacgaggatcaccgcgagctcgttctcgttcgcgacatcccgttttat
tcgacgtgtgaacaccacctcgtgccttttttcgggcacgctcacattggctatatcccg
ggcacctcgggcaaagttaccggcctttccaagctcgcgcgcctcatcgatggccttgcc
aagcgcccccaagtgcaagaacggctgacgtcccaagtcgcggatgctttggtggaacgc
ctcgaagcctccgcagtcatcgtcgtcattgaagctgaacatctttgcatggccatgcgc
ggcatccgcaaacccggtgcgaacacggtcacttctgcggttcgaggcggtttccgcacg
aatgccagttcccgcgcagaagccatggctttgattcaacgaggccgctaa

DBGET integrated database retrieval system