KEGG   Corynebacterium resistens: CRES_0184Help
Entry
CRES_0184         CDS       T01538                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
crd  Corynebacterium resistens
Pathway
crd00790  Folate biosynthesis
crd01100  Metabolic pathways
Module
crd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CRES_0184 (folP)
Enzymes [BR:crd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CRES_0184 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEI08547
UniProt: F8E1Z3
Position
223987..224931
Genome map
AA seq 314 aa AA seqDB search
MSDAPLPPPTPSFGANGSPTKVMGILNVTEDSFSDGGSNPDTATAVRNAKAMLTAGADII
DIGGESTRPGATRVSAEVEAARVVSVVRELVQLTHEPRTKPFTTSIDTMRASTARVALEA
GATFINDVSGGLADPEMLSVCADFDCPVILMHWEKDWGSASAQVGAEGYRDHGVDIVTEV
SNWLLARVEEAEKRGVDRKRIYLDPGIGFAKSPRDNWQLLHGLNRIVDLGFPVLVGASRK
RFLTALRPGPDGNPGTPESADDATAAVTSLAALAGAWAVRVHNVAPSKAAVDVIHAVRTG
DGPQVAEDWRAKRG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgccccgctgcccccacctacgccatccttcggcgcaaacggttcccccacg
aaggtgatgggaattctcaacgtgacggaggattctttctccgacggtggctccaaccca
gatacggccacggcagtccgtaatgccaaggcgatgcttacagccggggcagacatcatc
gatatcggcggggaatccacccgccccggcgctacgcgcgtttctgctgaggttgaagct
gcgcgagttgtttcagtcgtccgcgaactcgttcagctcactcacgaacctcgcaccaag
ccattcaccaccagcatcgatacgatgcgggcttccaccgcacgcgtggcactggaagct
ggggcgacgttcatcaacgatgtctccggtggcctcgcggatcccgagatgctttcggtg
tgcgcggatttcgattgcccagtgatcctcatgcactgggagaaagactggggtagtgcc
tccgcccaagtgggggcggagggctaccgcgatcacggtgtggacatcgtcaccgaggtc
tccaactggctgctagcgcgggtggaggaagcggagaagcgtggcgtcgatcgaaaaagg
atctatctggacccagggattggttttgcgaagagcccgcgcgacaattggcagttgttg
cacggcctgaaccgcatcgtcgatctgggatttccggtgctggtgggtgctagtcgaaag
cgtttcctcactgctctgcggccaggaccggatgggaaccccggcacaccggaatctgcg
gatgatgccactgcggcggtgacgagcttggcggcgctggctggtgcatgggcggtgcgg
gtgcataatgtagctccatctaaggctgcggtggatgtgatccacgcagtccgcaccggt
gacggcccgcaggtggccgaagattggagggccaagcgtggctga

DBGET integrated database retrieval system