KEGG   Corynebacterium resistens: CRES_0186Help
Entry
CRES_0186         CDS       T01538                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
crd  Corynebacterium resistens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CRES_0186 (folK)
Enzymes [BR:crd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CRES_0186 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
225336..225902
Genome map
AA seq 188 aa AA seqDB search
MLSLGSNVSGDTPSPAHQVARALRLLCEHSQVELAEASRLFATPPWGGVSQEEFRNATIS
LKTTLAPLALLHHCQGIECAADRRREVRWGPRTLDVDILAFFNDVHEPIVSAGQWGEELL
LPHPYAHQRAFVLLPWMDLPSAREPWCILPTGTESKTVAQWLEVVDPAEVAGVVPAADEV
WGSSVASI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgctttcccttggcagcaacgtttccggtgatacccccagccctgctcaccaggtagcg
cgcgcgttgcgccttttgtgcgagcactcacaggttgaactggccgaagcttcgcgcttg
tttgccacaccgccgtggggcggggtcagccaagaggaattccgcaacgccacaattagc
ttaaaaaccacgcttgccccactggcattgttgcaccactgtcagggcatagagtgcgcc
gctgatcgtcgccgcgaggttcgctgggggccccgtacgttagatgtggatattctggct
ttctttaatgacgtccacgagcccattgtttccgctggacagtggggtgaagagctactt
ctgccgcatccctatgcgcaccagcgcgcatttgtgttgcttccatggatggatttgccg
agtgcgcgggaaccgtggtgcattctgcccacgggtaccgagtcaaaaaccgtggcccaa
tggttggaggttgtggatcctgctgaggtggccggcgtggtgccagcggcagacgaggtg
tgggggagcagtgtggcgtcgatatag

DBGET integrated database retrieval system