KEGG   Corynebacterium resistens: CRES_0343Help
Entry
CRES_0343         CDS       T01538                                 

Gene name
echA4
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
crd  Corynebacterium resistens
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CRES_0343 (echA4)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CRES_0343 (echA4)
   00650 Butanoate metabolism
    CRES_0343 (echA4)
  Lipid metabolism
   00071 Fatty acid degradation
    CRES_0343 (echA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CRES_0343 (echA4)
   00310 Lysine degradation
    CRES_0343 (echA4)
   00360 Phenylalanine metabolism
    CRES_0343 (echA4)
   00380 Tryptophan metabolism
    CRES_0343 (echA4)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CRES_0343 (echA4)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CRES_0343 (echA4)
   00281 Geraniol degradation
    CRES_0343 (echA4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CRES_0343 (echA4)
   00627 Aminobenzoate degradation
    CRES_0343 (echA4)
   00930 Caprolactam degradation
    CRES_0343 (echA4)
Enzymes [BR:crd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CRES_0343 (echA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
400890..401672
Genome map
AA seq 260 aa AA seqDB search
MNQPSQTDTVLVEQRGVVTIITLNRPESRNALREQECLAMAEAVRVAGEPAGEDKANPDA
TAARAVLIRGEGPVFCAGADLKGAVYGDDFGGAITQMLQTIVRAPIPVIADIQGPAVGAG
CQLALACDLRIFGDDAKVWIPAADHGLALDTWTHVRAKELLGGAVARNLFLGSASVGVEQ
AVALGFAVKRGDAAAALEFAEDVARKAPLTLAYSKAVLNHPDPHGDVELDAMFRGVWASE
DVQEARRARAEKRAPRFHGR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagccatcccagaccgatactgttctcgtggagcagcggggcgtcgtcacgata
attaccctgaaccgacccgaaagccgcaatgcactgcgggagcaagagtgcttggcgatg
gcagaggcagtccgtgttgcgggggagccggctggggaggataaggcgaaccctgatgca
actgcggcgcgggcggtactcattcgtggcgaggggccagtattttgcgcgggggcggac
ctcaagggggcggtgtacggcgatgatttcggcggggcgatcacgcaaatgctgcagaca
attgtgcgagctccgattcctgtgattgctgatattcaggggccggctgtgggtgcaggt
tgtcagttggctttggcgtgtgacttgcggatttttggggatgacgccaaggtctggatt
cccgccgctgaccatgggctggcgctggatacgtggacgcatgtgcgggcgaaggaattg
ttaggcggggctgtggctaggaacctgttcctgggttcggcttccgtgggggttgagcag
gcggtagcgcttggttttgcagtgaagcgtggtgacgcagctgcggcgctggaattcgcg
gaagatgttgcccggaaggccccgctgacgctggcttatagcaaggcggtgctgaaccac
ccggacccccacggggatgtggagttggatgcgatgttccgtggtgtgtgggccagcgag
gatgtgcaagaagcgcgccgggcgcgggcggagaaacgcgcgccgcggttccatgggcga
tag

DBGET integrated database retrieval system