KEGG   Corynebacterium resistens: CRES_0343Help
Entry
CRES_0343         CDS       T01538                                 

Gene name
echA4
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
crd  Corynebacterium resistens
Pathway
crd00071  Fatty acid degradation
crd00280  Valine, leucine and isoleucine degradation
crd00281  Geraniol degradation
crd00310  Lysine degradation
crd00360  Phenylalanine metabolism
crd00362  Benzoate degradation
crd00380  Tryptophan metabolism
crd00410  beta-Alanine metabolism
crd00627  Aminobenzoate degradation
crd00640  Propanoate metabolism
crd00650  Butanoate metabolism
crd00903  Limonene and pinene degradation
crd00930  Caprolactam degradation
crd01100  Metabolic pathways
crd01110  Biosynthesis of secondary metabolites
crd01120  Microbial metabolism in diverse environments
crd01130  Biosynthesis of antibiotics
crd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:crd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CRES_0343 (echA4)
   00650 Butanoate metabolism
    CRES_0343 (echA4)
  Lipid metabolism
   00071 Fatty acid degradation
    CRES_0343 (echA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CRES_0343 (echA4)
   00310 Lysine degradation
    CRES_0343 (echA4)
   00360 Phenylalanine metabolism
    CRES_0343 (echA4)
   00380 Tryptophan metabolism
    CRES_0343 (echA4)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CRES_0343 (echA4)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CRES_0343 (echA4)
   00281 Geraniol degradation
    CRES_0343 (echA4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CRES_0343 (echA4)
   00627 Aminobenzoate degradation
    CRES_0343 (echA4)
   00930 Caprolactam degradation
    CRES_0343 (echA4)
Enzymes [BR:crd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CRES_0343 (echA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEI08706
UniProt: F8DXG1
Position
400890..401672
Genome map
AA seq 260 aa AA seqDB search
MNQPSQTDTVLVEQRGVVTIITLNRPESRNALREQECLAMAEAVRVAGEPAGEDKANPDA
TAARAVLIRGEGPVFCAGADLKGAVYGDDFGGAITQMLQTIVRAPIPVIADIQGPAVGAG
CQLALACDLRIFGDDAKVWIPAADHGLALDTWTHVRAKELLGGAVARNLFLGSASVGVEQ
AVALGFAVKRGDAAAALEFAEDVARKAPLTLAYSKAVLNHPDPHGDVELDAMFRGVWASE
DVQEARRARAEKRAPRFHGR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagccatcccagaccgatactgttctcgtggagcagcggggcgtcgtcacgata
attaccctgaaccgacccgaaagccgcaatgcactgcgggagcaagagtgcttggcgatg
gcagaggcagtccgtgttgcgggggagccggctggggaggataaggcgaaccctgatgca
actgcggcgcgggcggtactcattcgtggcgaggggccagtattttgcgcgggggcggac
ctcaagggggcggtgtacggcgatgatttcggcggggcgatcacgcaaatgctgcagaca
attgtgcgagctccgattcctgtgattgctgatattcaggggccggctgtgggtgcaggt
tgtcagttggctttggcgtgtgacttgcggatttttggggatgacgccaaggtctggatt
cccgccgctgaccatgggctggcgctggatacgtggacgcatgtgcgggcgaaggaattg
ttaggcggggctgtggctaggaacctgttcctgggttcggcttccgtgggggttgagcag
gcggtagcgcttggttttgcagtgaagcgtggtgacgcagctgcggcgctggaattcgcg
gaagatgttgcccggaaggccccgctgacgctggcttatagcaaggcggtgctgaaccac
ccggacccccacggggatgtggagttggatgcgatgttccgtggtgtgtgggccagcgag
gatgtgcaagaagcgcgccgggcgcgggcggagaaacgcgcgccgcggttccatgggcga
tag

DBGET integrated database retrieval system